StarFunc result for job id B2RTY4

User Input

>input (2548 residues)
MNINDGGRRRFEDNEHTLRIYPGAISEGTIYCPIPARKNSTAAEVIESLINKLHLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRKKNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEDERSAFHLKQPEE
YHYLNQITKKPLRQSWDDYCYDSEPDCFTVEGEDLRHDFERLQLAMEMVGFLPKTRRQIF
SLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEALVTRKTVTVGE
KLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEHNTKTLSIGVLDIFG
FEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLIS
KKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEDNSYIEFPAVMEPAFIIKHYAGKVKYG
VKDFREKNTDHMRPDIVALLRSSKNAFISGMIGIDPVAVFRWAILRAFFRAMVAFREAGK
RNIHRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSD
LQGMNALNEKNQHDTFDIAWNGRTGIRQSRLSSGTSLLDKDGIFANSTSSKLLERAHGIL
TRNKNFKSKPALPKHLLEVNSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLSK
LMETLGQAEPYFVKCIRSNAEKLPLRFSDVLVLRQLRYTGMLETVRIRQSGYSSKYSFQD
FVSHFHVLLPRNIIPSKFNIQDFFRKINLNPDNYQVGKTMVFLKEQERQHLQDLLHQEVL
RRIILLQRWFRVLLCRQHFLHLRQASVIIQRFWRNYLNQKQVRDAAVQKDAFVMASAAAL
LQASWRAHLERQRYLELRAAAIVIQQKWRDYYRRRHMAAICIQARWKAYRESKRYQEQRK
KIILLQSTCRGFRARQRFKALKEQRLRETKPEVGLVNIKGYGSLEIQGSDPSGWEDCSFD
NRIKAIEECKSVIESNRISRESSVDCLKESPNKQQERAQSQSGVDLQEDVLVRERPRSLE
DLHQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGISPSEDRRWSTELVPEGLQSPRG
TPDSESSQGSLELLSYEESQKSKLESVISDEGDLQFPSPKISSSPKFDSRDNALSASNET
SSAEHLKDGTMKEMVVCSSESITCKPQLKDSFISNSLPTFFYIPQQDPLKTNSQLDTSIQ
RNKLLENEDTAGEALTLDINRETRRYHCSGKDQIVPSLNTESSNPVLKKLEKLNTEKEER
QKQLQQQNEKEMMEQIRQQTDILEKERKAFKTIEKPRIGECLVAPSSYQSKQRVERPSSL
LSLNTSNKGELNVLGSLSLKDAALAQKDSSSAHLPPKDRPVTVFFERKGSPCQSSTVKEL
SKTDRMGTQLNVACKLSNNRISKREHFRPTQSYSHNSDDLSREGNARPIFFTPKDNMSIP
LVSKEALNSKNPQLHKEDEPAWKPVKLAGPGQRETSQRFSSVDEQAKLHKTMSQGEITKL
AVRQKASDSDIRPQRAKMRFWAKGKQGEKKTTRVKPTTQSEVSPLFAGTDVIPAHQFPDE
LAAYHPTPPLSPELPGSCRKEFKENKEPSPKAKRKRSVKISNVALDSMHWQNDSVQIIAS
VSDLKSMDEFLLKKVNDLDNEDSKKDTLVDVVFKKALKEFRQNIFSFYSSALAMDDGKSI
RYKDLYALFEQILEKTMRLEQRDSLGESPVRVWVNTFKVFLDEYMNEFKTSDCTATKVPK
TERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACHKKC
CLKTTAKCSKKYDPELSSRQFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKS
GSTNKIKELRQGLDTDAESVNLDDYNIHVIASVFKQWLRDLPNPLMTFELYEEFLRAMGL
QERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEDTNRMSANALAIVFAPCILRC
PDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAENKAKTRLSLIRRSMG
KGRIRRGNYPGPSSPVVVRLPSVSDVSEETLTSEAAMETDITEQQQAAMQQEERVLTEQI
ENLQKEKEELTFEMLVLEPRASDDETLESEASIGTADSSENLNMESEYAISEKSERSLAL
SSLKTAGKSEPSSKLRKQLKKQQDSLDVVDSSVSSLCLSNTASSHGTRKLFQIYSKSPFY
RAASGNEALGMEGPLGQTKFLEDKPQFISRGTFNPEKGKQKLKNVKNSPQKTKETPEGTV
MSGRRKTVDPDCTSNQQLALFGNNEFMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RTY4	1.000	1.000	0.000	2548	1.000	1.000	B2RTY4.pdb.gz	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2
2	AFDB:E7EZG2	0.405	0.408	0.000	2522	0.637	0.644	E7EZG2.pdb.gz	MY9AA_DANRE Unconventional myosin-IXAa OS=Danio rerio OX=7955 GN=myo9aa PE=3 SV=1
3	AFDB:Q13459	0.404	0.470	0.000	2157	0.384	0.454	Q13459.pdb.gz	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
4	AFDB:Q8C170	0.411	0.412	0.000	2542	0.888	0.890	Q8C170.pdb.gz	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
5	AFDB:Q9QY06	0.386	0.455	0.000	2114	0.385	0.465	Q9QY06.pdb.gz	MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus OX=10090 GN=Myo9b PE=1 SV=2
6	AFDB:Q9Z1N3	0.360	0.351	0.000	2626	0.886	0.860	Q9Z1N3.pdb.gz	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
7	AFDB:Q9TZI9	0.257	0.529	3.007E-57	1219	0.120	0.250	Q9TZI9.pdb.gz	Q9TZI9_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spe-15 PE=1 SV=1
8	AFDB:Q5DU14	0.265	0.348	4.361E-54	1919	0.141	0.187	Q5DU14.pdb.gz	MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus OX=10090 GN=Myo16 PE=1 SV=2
9	PDB:4anjA	0.240	0.598	4.595E-52	995	0.102	0.261	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
10	PDB:4pa0A	0.222	0.557	2.173E-46	974	0.094	0.246	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
11	PDB:6ycxB	0.252	0.747	4.281E-46	817	0.088	0.274	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
12	PDB:4pa0B	0.222	0.587	4.903E-46	920	0.093	0.259	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.224	0.573	5.653E-44	952	0.089	0.238	4p7hB.pdb.gz
14	PDB:7mf3B	0.261	0.702	6.538E-41	896	0.109	0.310	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
15	PDB:5tbyA	0.246	0.613	2.797E-38	954	0.105	0.281	5tbyA.pdb.gz
16	AFDB:E9PV66	0.246	0.241	5.937E-29	2605	0.130	0.127	E9PV66.pdb.gz	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
17	AFDB:X2JEI9	0.085	0.096	5.429E-15	2206	0.080	0.092	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
18	PDB:1xa6A	0.072	0.427	2.116E-13	399	0.032	0.203	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
19	PDB:3cxlA	0.072	0.443	8.593E-13	402	0.031	0.194	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
20	PDB:6r3vA	0.073	0.879	2.331E-11	198	0.024	0.303	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RTY4	0.0	5302	2548	1.000	1.000	MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A PE=1 SV=2
2	E7EZG2	0.0	3038	2522	0.647	0.653	MY9AA_DANRE Unconventional myosin-IXAa OS=Danio rerio OX=7955 GN=myo9aa PE=3 SV=1
3	E7F3F0	0.0	1659	2286	0.337	0.376	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
4	F0IWT2	0.0	644	1880	0.129	0.175	F0IWT2_CAEEL Unconventional myosin-IXa-like OS=Caenorhabditis elegans OX=6239 GN=hum-7 PE=1 SV=1
5	H2L082	0.0	644	1867	0.129	0.176	H2L082_CAEEL Unconventional myosin-IXa-like OS=Caenorhabditis elegans OX=6239 GN=hum-7 PE=1 SV=1
6	M0R0P8	0.0	1261	2157	0.252	0.297	M0R0P8_HUMAN Myosin IXB OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=1
7	M0R300	0.0	1262	2071	0.252	0.310	M0R300_HUMAN Myosin IXB (Fragment) OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=8
8	Q13459	0.0	1261	2157	0.252	0.297	MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3
9	Q63358	0.0	1254	1980	0.251	0.323	MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus OX=10116 GN=Myo9b PE=1 SV=1
10	Q8C170	0.0	4576	2542	0.889	0.891	MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus OX=10090 GN=Myo9a PE=1 SV=2
11	Q9QY06	0.0	983	2114	0.186	0.224	MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus OX=10090 GN=Myo9b PE=1 SV=2
12	Q9Z1N3	0.0	4366	2626	0.867	0.842	MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus OX=10116 GN=Myo9a PE=1 SV=1
13	Q9U1M8	1.51e-140	494	2357	0.098	0.106	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
14	Q8IPH7	5.61e-136	457	1034	0.093	0.229	Q8IPH7_DROME Myosin 28B1, isoform C OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=2
15	Q8IPH6	7.28e-136	457	1033	0.093	0.229	Q8IPH6_DROME FI20293p1 OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=2
16	Q7YU72	8.23e-136	456	1035	0.093	0.229	Q7YU72_DROME RH39293p OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=2 SV=1
17	Q9UKN7	4.11e-132	469	3530	0.098	0.071	MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens OX=9606 GN=MYO15A PE=1 SV=2
18	Q9QZZ4	1.57e-131	467	3511	0.097	0.070	MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus OX=10090 GN=Myo15a PE=1 SV=2
19	A0A0G2K1F7	1.67e-131	467	3512	0.096	0.069	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
20	A0A0G2JTE7	1.71e-131	467	3494	0.096	0.070	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.1e+02	14.6	AAA ATPase domain
2	PF13401 AAA_22	1.6e+02	13.9	AAA domain
3	PF00130 C1_1	0.022	25.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF00612 IQ	1.6e-07	41.5	IQ calmodulin-binding motif
5	PF00063 Myosin_head	2.5e-207	702.0	Myosin head (motor domain)
6	PF00788 RA	2.1e-20	84.5	Ras association (RalGDS/AF-6) domain
7	PF00620 RhoGAP	4.4e-44	161.4	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358994	0.929	Unconventional myosin-VI
2	9606.ENSP00000352834	0.921	Unconventional myosin-Ic
3	9606.ENSP00000334563	0.918	Unconventional myosin-XVIIIb
4	9606.ENSP00000344871	0.912	Unconventional myosin-If
5	9606.ENSP00000450385	0.808	Myosin light chain 6B
6	9606.ENSP00000446955	0.781	Myosin light polypeptide 6
7	9606.ENSP00000477310	0.724	Dynein light chain 2, cytoplasmic
8	9606.ENSP00000268057	0.657	Bardet-Biedl syndrome 4 protein
9	9606.ENSP00000383118	0.612	Cell division control protein 42 homolog
10	9606.ENSP00000295095	0.573	Rho GTPase-activating protein 15
11	9606.ENSP00000332681	0.570	LRP2-binding protein
12	9606.ENSP00000403323	0.566	Rho GTPase-activating protein 27
13	9606.ENSP00000400175	0.519	Transforming protein RhoA
14	9606.ENSP00000352925	0.515	Transformation/transcription domain-associated protein
15	9606.ENSP00000261517	0.507	Vacuolar protein sorting-associated protein 13C
16	9606.ENSP00000315659	0.506	Dynamin-binding protein
17	9606.ENSP00000295314	0.500	Tropomodulin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0005096	0.996	GTPase activator activity
GO:0003774	0.660	cytoskeletal motor activity
GO:0000146	0.611	microfilament motor activity
GO:0008092	0.466	cytoskeletal protein binding
GO:0019899	0.301	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0032501	0.950	multicellular organismal process
GO:0048856	0.950	anatomical structure development
GO:0016043	0.949	cellular component organization
GO:0034330	0.739	cell junction organization
GO:0030154	0.651	cell differentiation
GO:0050808	0.614	synapse organization
GO:0050896	0.598	response to stimulus
GO:0009888	0.542	tissue development
GO:0048583	0.528	regulation of response to stimulus
GO:0009653	0.526	anatomical structure morphogenesis
GO:0051716	0.469	cellular response to stimulus
GO:0007165	0.456	signal transduction
GO:0009966	0.413	regulation of signal transduction
GO:0007275	0.411	multicellular organism development
GO:1902531	0.391	regulation of intracellular signal transduction
GO:0051056	0.329	regulation of small GTPase mediated signal transduction
GO:0006996	0.323	organelle organization
GO:0022607	0.323	cellular component assembly
GO:0048518	0.307	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0030054	0.977	cell junction
GO:0016020	0.878	membrane
GO:0043226	0.873	organelle
GO:0043229	0.854	intracellular organelle
GO:0042995	0.812	cell projection
GO:0120025	0.794	plasma membrane bounded cell projection
GO:0043227	0.788	membrane-bounded organelle
GO:0043231	0.678	intracellular membrane-bounded organelle
GO:0045202	0.616	synapse
GO:0071944	0.483	cell periphery
GO:0043232	0.473	intracellular non-membrane-bounded organelle
GO:0043005	0.396	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.611	myosin ATPase.

[back to server]