StarFunc result for job id B2RUY7

User Input

>input (222 residues)
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAG
TTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RUY7	1.000	1.000	1.458E-43	222	1.000	1.000	B2RUY7.pdb.gz	VWC2L_HUMAN von Willebrand factor C domain-containing protein 2-like OS=Homo sapiens OX=9606 GN=VWC2L PE=1 SV=1
2	AFDB:B0UZC8	0.811	0.807	3.561E-37	223	0.784	0.780	B0UZC8.pdb.gz	VWC2L_DANRE von Willebrand factor C domain-containing protein 2-like OS=Danio rerio OX=7955 GN=vwc2l PE=2 SV=1
3	AFDB:Q2TAL6	0.684	0.482	3.595E-26	325	0.509	0.348	Q2TAL6.pdb.gz	VWC2_HUMAN Brorin OS=Homo sapiens OX=9606 GN=VWC2 PE=1 SV=1
4	AFDB:B0I1T8	0.638	0.478	2.845E-25	309	0.518	0.372	B0I1T8.pdb.gz	B0I1T8_DANRE Brorin OS=Danio rerio OX=7955 GN=brorin PE=2 SV=1
5	AFDB:Q9Z0E2	0.250	0.078	1.782E-10	948	0.225	0.053	Q9Z0E2.pdb.gz	CHRD_MOUSE Chordin OS=Mus musculus OX=10090 GN=Chrd PE=1 SV=1
6	AFDB:G5EF34	0.262	0.066	2.233E-9	966	0.198	0.046	G5EF34.pdb.gz	G5EF34_CAEEL Cysteine-rich motor neuron 1 protein-like OS=Caenorhabditis elegans OX=6239 GN=crm-1 PE=1 SV=1
7	AFDB:Q96DN2	0.412	0.132	1.252E-8	955	0.221	0.051	Q96DN2.pdb.gz	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2
8	AFDB:Q04164	0.241	0.046	3.933E-7	1693	0.230	0.030	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
9	AFDB:A0A0G2K8X5	0.234	0.075	1.654E-6	1032	0.189	0.041	A0A0G2K8X5.pdb.gz	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
10	AFDB:F1LQ00	0.248	0.039	1.225E-3	1494	0.144	0.021	F1LQ00.pdb.gz	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
11	PDB:3ix0B	0.205	0.430	2.209E-1	94	0.068	0.160	3ix0B.pdb.gz
12	PDB:8a7dQ	0.077	0.081	5.231E-1	273	0.117	0.095	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
13	PDB:3t5oA	0.141	0.053	1.042	871	0.113	0.029	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
14	PDB:7trcK	0.106	0.073	1.042	330	0.086	0.058	7trcK.pdb.gz	Structure of active human telomerase with telomere shelterin protein TPP1.
15	PDB:4rulA	0.106	0.044	1.389	823	0.104	0.028	4rulA.pdb.gz	Structural basis for suppression of hypernegative DNA supercoiling by E. coli topoisomerase I.
16	PDB:5ie2A	0.068	0.038	1.471	506	0.045	0.020	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
17	PDB:1gjqA	0.086	0.045	2.077	541	0.090	0.037	1gjqA.pdb.gz	Cyanide Binding to Cd(1) Nitrite Reductase from Pseudomonas Aeruginosa: Role of the Active-Site His369 in Ligand Stabilization.
18	PDB:7kgbC	0.099	0.082	2.330	272	0.072	0.059	7kgbC.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
19	PDB:4a5wB	0.113	0.043	2.468	871	0.104	0.026	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
20	PDB:7zu0A	0.094	0.030	2.468	954	0.068	0.016	7zu0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RUY7	9.97e-163	449	222	1.000	1.000	VWC2L_HUMAN von Willebrand factor C domain-containing protein 2-like OS=Homo sapiens OX=9606 GN=VWC2L PE=1 SV=1
2	Q505H4	2.74e-161	446	222	0.986	0.986	VWC2L_MOUSE von Willebrand factor C domain-containing protein 2-like OS=Mus musculus OX=10090 GN=Vwc2l PE=1 SV=1
3	B0UZC8	1.01e-129	366	223	0.784	0.780	VWC2L_DANRE von Willebrand factor C domain-containing protein 2-like OS=Danio rerio OX=7955 GN=vwc2l PE=2 SV=1
4	B0I1T8	4.08e-77	236	309	0.509	0.366	B0I1T8_DANRE Brorin OS=Danio rerio OX=7955 GN=brorin PE=2 SV=1
5	Q8C8N3	8.93e-76	233	324	0.518	0.355	VWC2_MOUSE Brorin OS=Mus musculus OX=10090 GN=Vwc2 PE=1 SV=1
6	Q2TAL6	7.58e-75	231	325	0.486	0.332	VWC2_HUMAN Brorin OS=Homo sapiens OX=9606 GN=VWC2 PE=1 SV=1
7	Q3U492	1.54e-06	50.8	1550	0.252	0.036	KCP_MOUSE Kielin/chordin-like protein OS=Mus musculus OX=10090 GN=Kcp PE=1 SV=2
8	A0A0R4IQJ3	9.51e-06	48.5	4003	0.189	0.010	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
9	F1Q633	9.59e-06	48.5	3970	0.189	0.011	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1
10	A0A8I6AII1	1.18e-05	48.1	1497	0.104	0.015	A0A8I6AII1_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=1
11	A0A8I6GEX8	1.20e-05	48.1	1498	0.104	0.015	A0A8I6GEX8_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=4 SV=1
12	Q9BU40	1.32e-05	47.4	456	0.194	0.094	CRDL1_HUMAN Chordin-like protein 1 OS=Homo sapiens OX=9606 GN=CHRDL1 PE=1 SV=2
13	F1LQ00	1.50e-05	47.8	1499	0.104	0.015	F1LQ00_RAT Collagen type V alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col5a2 PE=1 SV=4
14	P05997	2.63e-05	47.0	1499	0.099	0.015	CO5A2_HUMAN Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3
15	Q920C1	3.57e-05	46.2	447	0.189	0.094	CRDL1_MOUSE Chordin-like protein 1 OS=Mus musculus OX=10090 GN=Chrdl1 PE=1 SV=1
16	Q76LD0	4.14e-05	46.2	447	0.189	0.094	CRDL1_RAT Chordin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Chrdl1 PE=2 SV=2
17	P28481	4.24e-05	46.2	1487	0.099	0.015	CO2A1_MOUSE Collagen alpha-1(II) chain OS=Mus musculus OX=10090 GN=Col2a1 PE=1 SV=2
18	Q3U962	6.24e-05	45.8	1497	0.099	0.015	CO5A2_MOUSE Collagen alpha-2(V) chain OS=Mus musculus OX=10090 GN=Col5a2 PE=1 SV=1
19	Q7T3Q2	6.99e-05	45.4	1027	0.135	0.029	CRIM1_DANRE Cysteine-rich motor neuron 1 protein OS=Danio rerio OX=7955 GN=crim1 PE=2 SV=1
20	Q96DN2	1.35e-04	44.7	955	0.225	0.052	VWCE_HUMAN von Willebrand factor C and EGF domain-containing protein OS=Homo sapiens OX=9606 GN=VWCE PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00093 VWC	2.3e-05	35.9	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008786

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012449	0.872	annotation not available
2	61853.ENSNLEP00000007689	0.851	Glutamate receptor, ionotropic, AMPA 2
3	61853.ENSNLEP00000014471	0.851	Calcium channel, voltage-dependent, gamma subunit 3
4	61853.ENSNLEP00000017831	0.848	Multifunctional fusion protein
5	61853.ENSNLEP00000005572	0.847	Von Willebrand factor C domain containing 2
6	61853.ENSNLEP00000008788	0.846	Glutamate receptor, ionotropic, AMPA 4
7	61853.ENSNLEP00000012545	0.845	Shisa family member 6
8	61853.ENSNLEP00000020057	0.844	Glutamate receptor, ionotropic, AMPA 1
9	61853.ENSNLEP00000010720	0.843	Olfactomedin 1
10	61853.ENSNLEP00000000297	0.842	Regulates the activity of L-type calcium channels that contain CACNA1C as pore-forming subunit (By similarity). Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs), including GRIA1 and GRIA4. Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization
11	61853.ENSNLEP00000009746	0.842	Discs, large homolog 4 (Drosophila)
12	61853.ENSNLEP00000013991	0.842	Neuritin 1
13	61853.ENSNLEP00000014568	0.842	Olfactomedin 3
14	61853.ENSNLEP00000014592	0.842	Olfactomedin 2
15	61853.ENSNLEP00000008907	0.840	Abhydrolase domain containing 6
16	61853.ENSNLEP00000018295	0.839	Glutamate receptor, ionotropic, AMPA 3
17	61853.ENSNLEP00000001415	0.835	Leucine rich repeat transmembrane neuronal 4
18	61853.ENSNLEP00000001169	0.833	Discs, large homolog 3 (Drosophila)
19	61853.ENSNLEP00000006435	0.833	Carnitine palmitoyltransferase 1C
20	61853.ENSNLEP00000008789	0.711	BRCA1 associated RING domain 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0023051	0.916	regulation of signaling
GO:0010646	0.916	regulation of cell communication
GO:0090101	0.895	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090288	0.795	negative regulation of cellular response to growth factor stimulus
GO:0030514	0.747	negative regulation of BMP signaling pathway
GO:0048518	0.702	positive regulation of biological process
GO:0050793	0.618	regulation of developmental process
GO:0048522	0.469	positive regulation of cellular process
GO:0032501	0.438	multicellular organismal process
GO:0051094	0.434	positive regulation of developmental process
GO:0050896	0.387	response to stimulus
GO:0009987	0.381	cellular process
GO:0045664	0.301	regulation of neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005615	0.996	extracellular space
GO:0098796	0.995	membrane protein complex
GO:0008328	0.985	ionotropic glutamate receptor complex
GO:0032281	0.907	AMPA glutamate receptor complex
GO:0043226	0.395	organelle
GO:0043231	0.353	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]