StarFunc result for job id B3EWF7

User Input

>input (344 residues)
MHPKEGAEQHVFSPVPGAPTPPPNRCGRLVLGPRLPAAGTPGPGIRAAAARHALPLWGGG
ATRRGRRPAGAAGGGVAARAGALGAARCRPPEAGRHRGGRRGPGPAGAGPVARGGGAGGR
GGGAGRGGAGPRGHVLVQVPEAGAGRRALLGRYCQQTPAPGAERELRPAPPTGASASGRP
RRPRRRASRAFCPRPCALPGRPGLTLLCRPRCRRQPRLRLPTDSLDPYSAPGRLPAHSVA
CPSDLVSAHPVLSFFPTAPASRASALRLPPGAPFALRVPLDLRVPPFAGPLAARPRAADG
FNSPTPPWLGFVSSFSCSNSLKKTQNDPTNETSVFANPRQQCAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3EWF7	1.000	1.000	4.863E-54	344	1.000	1.000	B3EWF7.pdb.gz	EP2A2_HUMAN Laforin, isoform 9 OS=Homo sapiens OX=9606 GN=EPM2A PE=1 SV=1
2	AFDB:Q8SYB4	0.081	0.067	1.035	436	0.134	0.106	Q8SYB4.pdb.gz	Q8SYB4_DROME RE74364p OS=Drosophila melanogaster OX=7227 GN=CG11381 PE=2 SV=1
3	AFDB:P51115	0.066	0.038	1.585	676	0.166	0.084	P51115.pdb.gz	FXR1A_XENLA RNA-binding protein fxr1-A OS=Xenopus laevis OX=8355 GN=fxr1-a PE=1 SV=2
4	AFDB:Q09823	0.078	0.047	3.225	791	0.134	0.058	Q09823.pdb.gz	REC10_SCHPO Linear element protein rec10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rec10 PE=1 SV=2
5	AFDB:O95197	0.073	0.031	4.600	1032	0.128	0.043	O95197.pdb.gz	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
6	AFDB:Q20712	0.064	0.036	4.938	689	0.201	0.100	Q20712.pdb.gz	Q20712_CAEEL CLASP_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53B3.3 PE=1 SV=4
7	AFDB:Q9UKK3	0.087	0.028	5.302	1724	0.195	0.039	Q9UKK3.pdb.gz	PARP4_HUMAN Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3
8	AFDB:Q09829	0.104	0.063	5.692	780	0.137	0.060	Q09829.pdb.gz	YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.03c PE=4 SV=1
9	AFDB:Q385Z8	0.121	0.093	6.111	477	0.125	0.090	Q385Z8.pdb.gz	Q385Z8_TRYB2 PSP1 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1660 PE=4 SV=1
10	AFDB:A0A5F9UY30	0.083	0.066	6.561	453	0.157	0.119	A0A5F9UY30.pdb.gz	A0A5F9UY30_HUMAN Trans-golgi network protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3EWF7	0.0	639	344	1.000	1.000	EP2A2_HUMAN Laforin, isoform 9 OS=Homo sapiens OX=9606 GN=EPM2A PE=1 SV=1
2	A8TX70	0.001	43.1	2615	0.128	0.017	CO6A5_HUMAN Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5 PE=1 SV=1
3	A6H584	0.10	37.0	2640	0.125	0.016	CO6A5_MOUSE Collagen alpha-5(VI) chain OS=Mus musculus OX=10090 GN=Col6a5 PE=1 SV=4
4	P34109	0.72	34.3	1109	0.064	0.020	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
5	P55012	2.5	32.7	1205	0.078	0.022	S12A2_MOUSE Solute carrier family 12 member 2 OS=Mus musculus OX=10090 GN=Slc12a2 PE=1 SV=2
6	Q14151	3.9	32.0	953	0.093	0.034	SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1
7	Q38FX4	4.4	32.0	4479	0.073	0.006	Q38FX4_TRYB2 Fibronectin type-III domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.0650 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032006	0.786	regulation of TOR signaling
GO:0009894	0.750	regulation of catabolic process
GO:0048523	0.710	negative regulation of cellular process
GO:0048522	0.704	positive regulation of cellular process
GO:0010506	0.703	regulation of autophagy
GO:0016241	0.690	regulation of macroautophagy
GO:0010508	0.690	positive regulation of autophagy
GO:0032007	0.690	negative regulation of TOR signaling
GO:0016239	0.654	positive regulation of macroautophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005622	0.988	intracellular anatomical structure
GO:0043226	0.978	organelle
GO:0043229	0.946	intracellular organelle
GO:0043227	0.939	membrane-bounded organelle
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0005737	0.883	cytoplasm
GO:0005739	0.511	mitochondrion
GO:0031974	0.495	membrane-enclosed lumen
GO:0005730	0.420	nucleolus
GO:0005764	0.373	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]