StarFunc result for job id B4DS77

User Input

>input (424 residues)
MRRVLRLLLGCFLTELCARVCRAQERAGHGQLAQLGGVLLLAGGNRSGAASGEASEGAEA
SDAPPTRAPTPDFCRGYFDVMGQWDPPFNCSSGDFIFCCGTCGFRFCCTFKKRRLNQSTC
TNYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFTKLGLEKAHR
PQREHMSRALADVMRPQGHCNTDHMERDLNIVVHVQHYENMDTRTPINNLHATQMNNAVP
TSPLLQQMGHPHSYPNLGQISNPYEQQPPGKELNKYASLKAVGSSDGDWAVSTLKSPKAD
KVNDDFYTKRRHLAELAAKGNLPLHPVRVEDEPRAFSPEHGPAKQNGQKSRTNKMPPHPL
AYTSTTNFKGWDPNEQSLRRQAYSNKGKLGTAETGSSDPLGTRPQHYPPPQPYFITNSKT
EVTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CZN4	0.415	0.415	3.350E-62	424	0.936	0.936	Q9CZN4.pdb.gz	SHSA9_MOUSE Protein shisa-9 OS=Mus musculus OX=10090 GN=Shisa9 PE=1 SV=2
2	AFDB:O54951	0.101	0.056	1.164E-3	886	0.153	0.073	O54951.pdb.gz	SEM6B_MOUSE Semaphorin-6B OS=Mus musculus OX=10090 GN=Sema6b PE=1 SV=1
3	AFDB:A0A0B4LHR4	0.099	0.044	1.079E-2	1224	0.125	0.043	A0A0B4LHR4.pdb.gz	A0A0B4LHR4_DROME Metabotropic GABA-B receptor subtype 2, isoform C OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=4 SV=1
4	AFDB:Q9Y5G9	0.110	0.055	1.979E-2	962	0.106	0.047	Q9Y5G9.pdb.gz	PCDG4_HUMAN Protocadherin gamma-A4 OS=Homo sapiens OX=9606 GN=PCDHGA4 PE=1 SV=2
5	AFDB:Q91XX9	0.095	0.051	3.174E-2	932	0.108	0.049	Q91XX9.pdb.gz	Q91XX9_MOUSE Protocadherin gamma A9 OS=Mus musculus OX=10090 GN=Pcdhga9 PE=1 SV=1
6	AFDB:Q9Y5G4	0.100	0.053	3.174E-2	932	0.104	0.047	Q9Y5G4.pdb.gz	PCDG9_HUMAN Protocadherin gamma-A9 OS=Homo sapiens OX=9606 GN=PCDHGA9 PE=1 SV=1
7	AFDB:Q91XZ0	0.098	0.050	6.232E-2	931	0.099	0.045	Q91XZ0.pdb.gz	Q91XZ0_MOUSE Protocadherin gamma A1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
8	AFDB:Q91XY4	0.117	0.061	1.309E-1	930	0.113	0.052	Q91XY4.pdb.gz	PCDG4_MOUSE Protocadherin gamma-A4 OS=Mus musculus OX=10090 GN=Pcdhga4 PE=1 SV=1
9	AFDB:O95208	0.100	0.074	2.402E-1	641	0.163	0.108	O95208.pdb.gz	EPN2_HUMAN Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2 PE=1 SV=3
10	AFDB:P19880	0.098	0.067	2.749E-1	650	0.142	0.092	P19880.pdb.gz	AP1_YEAST AP-1-like transcription factor YAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP1 PE=1 SV=2
11	PDB:6edtJ	0.065	0.137	9.440E-1	109	0.042	0.165	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
12	PDB:6hivCR	0.105	0.134	3.639	314	0.045	0.061	6hivCR.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:7mqaSS	0.097	0.115	5.099	350	0.040	0.049	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:1tgsZ	0.039	0.062	5.455	225	0.014	0.027	1tgsZ.pdb.gz	Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.
15	PDB:4v88Ah	0.081	0.162	7.643	159	0.050	0.132	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
16	PDB:6hv92	0.042	0.035	8.176	549	0.017	0.013	6hv92.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.
17	PDB:5vaeB	0.035	0.094	8.747	134	0.009	0.030	5vaeB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CZN4	0.0	818	424	0.936	0.936	SHSA9_MOUSE Protein shisa-9 OS=Mus musculus OX=10090 GN=Shisa9 PE=1 SV=2
2	Q6ZSJ9	1.04e-50	180	500	0.233	0.198	SHSA6_HUMAN Protein shisa-6 OS=Homo sapiens OX=9606 GN=SHISA6 PE=1 SV=2
3	Q3UH99	5.62e-49	176	525	0.264	0.213	SHSA6_MOUSE Protein shisa-6 OS=Mus musculus OX=10090 GN=Shisa6 PE=1 SV=1
4	Q8C3Q5	1.55e-31	128	558	0.229	0.174	SHSA7_MOUSE Protein shisa-7 OS=Mus musculus OX=10090 GN=Shisa7 PE=1 SV=3
5	Q6UWI4	2.02e-08	57.8	295	0.078	0.112	SHSA2_HUMAN Protein shisa-2 homolog OS=Homo sapiens OX=9606 GN=SHISA2 PE=1 SV=1
6	Q8QZV2	3.71e-08	57.0	295	0.080	0.115	SHSA2_MOUSE Protein shisa-2 homolog OS=Mus musculus OX=10090 GN=Shisa2 PE=2 SV=1
7	A0PJX4	2.87e-06	50.4	238	0.071	0.126	SHSA3_HUMAN Protein shisa-3 homolog OS=Homo sapiens OX=9606 GN=SHISA3 PE=1 SV=1
8	Q3UPR0	2.17e-05	47.8	238	0.066	0.118	SHSA3_MOUSE Protein shisa-3 homolog OS=Mus musculus OX=10090 GN=Shisa3 PE=1 SV=1
9	Q96DD7	7.34e-04	42.7	197	0.045	0.096	SHSA4_HUMAN Protein shisa-4 OS=Homo sapiens OX=9606 GN=SHISA4 PE=1 SV=3
10	Q61003	0.26	36.2	665	0.073	0.047	CD6_MOUSE T-cell differentiation antigen CD6 OS=Mus musculus OX=10090 GN=Cd6 PE=1 SV=2
11	Q12113	2.3	33.1	1770	0.094	0.023	YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY2B-OR1 PE=3 SV=1
12	Q12491	2.9	32.7	1770	0.094	0.023	YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY2B-B PE=3 SV=1
13	Q8CJ11	3.0	32.7	1013	0.050	0.021	AGRG2_RAT Adhesion G-protein coupled receptor G2 OS=Rattus norvegicus OX=10116 GN=Adgrg2 PE=1 SV=1
14	Q03494	5.0	32.0	1770	0.092	0.022	YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY2B-DR2 PE=3 SV=2
15	A1Z8R2	7.1	31.6	1199	0.045	0.016	A1Z8R2_DROME ADD domain-containing protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ADD1 PE=1 SV=1
16	Q9VY72	7.5	31.6	1553	0.031	0.008	Q9VY72_DROME Maternal gene required for meiosis, isoform H OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05961 Chordopox_A13L	4.7e+02	12.4	Chordopoxvirus A13L protein
2	PF13908 Shisa	1.9e-45	166.9	Wnt and FGF inhibitory regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454014

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300105	0.934	Voltage-dependent calcium channel gamma-2 subunit
2	9606.ENSP00000428994	0.923	Glutamate receptor 1
3	9606.ENSP00000310003	0.920	Protein cornichon homolog 2
4	9606.ENSP00000270458	0.903	Voltage-dependent calcium channel gamma-8 subunit
5	9606.ENSP00000296526	0.870	Glutamate receptor 2
6	9606.ENSP00000382428	0.851	Disks large homolog 4
7	9606.ENSP00000272133	0.844	Protein cornichon homolog 3
8	9606.ENSP00000481554	0.826	Glutamate receptor 3
9	9606.ENSP00000282499	0.825	Glutamate receptor 4
10	9606.ENSP00000477455	0.783	Glutamate receptor ionotropic, NMDA 2B
11	9606.ENSP00000379818	0.780	Glutamate receptor ionotropic, NMDA 2A
12	9606.ENSP00000394954	0.775	Germ cell-specific gene 1-like protein
13	9606.ENSP00000360608	0.767	Glutamate receptor ionotropic, NMDA 1
14	9606.ENSP00000355155	0.757	Glutamate receptor ionotropic, NMDA 3A
15	9606.ENSP00000347754	0.752	5-hydroxytryptamine receptor 3A
16	9606.ENSP00000234389	0.748	Glutamate receptor ionotropic, NMDA 3B
17	9606.ENSP00000293190	0.742	Glutamate receptor ionotropic, NMDA 2C
18	9606.ENSP00000263269	0.741	Glutamate receptor ionotropic, NMDA 2D
19	9606.ENSP00000005284	0.740	Voltage-dependent calcium channel gamma-3 subunit
20	9606.ENSP00000366058	0.738	Synapse differentiation-inducing gene protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030165	1.000	PDZ domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0032409	0.968	regulation of transporter activity
GO:0099601	0.938	regulation of neurotransmitter receptor activity
GO:0032412	0.938	regulation of monoatomic ion transmembrane transporter activity
GO:0065008	0.799	regulation of biological quality
GO:0099177	0.785	regulation of trans-synaptic signaling
GO:0050804	0.690	modulation of chemical synaptic transmission
GO:0051239	0.639	regulation of multicellular organismal process
GO:0044057	0.590	regulation of system process
GO:0031644	0.573	regulation of nervous system process
GO:0009987	0.415	cellular process
GO:0048167	0.408	regulation of synaptic plasticity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098978	0.997	glutamatergic synapse
GO:0008328	0.996	ionotropic glutamate receptor complex
GO:0098839	0.996	postsynaptic density membrane
GO:0032281	0.994	AMPA glutamate receptor complex
GO:0031252	0.990	cell leading edge
GO:0030425	0.987	dendrite
GO:0031253	0.985	cell projection membrane
GO:0032590	0.980	dendrite membrane
GO:0044309	0.979	neuron spine
GO:0043197	0.974	dendritic spine
GO:0043229	0.820	intracellular organelle
GO:0043227	0.809	membrane-bounded organelle
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0005737	0.753	cytoplasm
GO:0032591	0.740	dendritic spine membrane
GO:0012505	0.319	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]