StarFunc result for job id B4DX44

User Input

>input (427 residues)
MGVLTFRDVAVEFSPEEWECLDSAQQRLYRDVMLENYGNLVSLGLAIFKPDLMTCLEQRK
EPWKVKRQEAVAKHPAGSFHFTAEILPDHDIKDSFQKVILRKYGSCDLNNLHLKKDYQSV
GNCKGQKSSYNGLHQCLSATHSKTCQCNKCGRGFQLCSIFTEHKDIFSREKCHKCEECGK
DCRLFSDFTRHKKIHTVERCYKCEECGKAFKKFSNLTEHKRVHTGEKPYKCEGCGKTFTC
SSTLVKHKRNHTGDRPYKCEECGKAFKCFSDLTNHKRIHTGEKPYKCEECNKAYRWFSDL
AKHKIIHTGDKPYTCNECGKAFKWFSALSKHKRIHTGEKPYICEECGKAFTRSSTLFNHK
RIHMEERPYKCEECSKTFKCFSDLTNHKRIHTGEKPYKCEECGKASSWFSHLIRHKRIHT
REKLHKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03936	0.356	0.279	7.764E-49	586	0.653	0.476	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
2	AFDB:O75437	0.314	0.227	1.788E-46	659	0.616	0.399	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	AFDB:A6NNF4	0.399	0.249	3.379E-46	738	0.614	0.355	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	AFDB:Q8IW36	0.489	0.412	9.036E-46	515	0.621	0.515	Q8IW36.pdb.gz	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
5	AFDB:Q8IYB9	0.377	0.270	1.207E-45	648	0.583	0.384	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
6	AFDB:Q05481	0.287	0.132	3.623E-45	1191	0.607	0.217	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
7	AFDB:Q8IYN0	0.361	0.303	4.310E-45	542	0.600	0.472	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
8	AFDB:Q14593	0.395	0.314	8.146E-45	569	0.600	0.450	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	AFDB:P35789	0.287	0.207	1.088E-44	620	0.585	0.403	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
10	AFDB:Q15928	0.392	0.359	1.088E-44	474	0.569	0.513	Q15928.pdb.gz	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
11	PDB:3w5kB	0.108	0.279	1.015E-4	110	0.089	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.065	0.206	4.471E-1	62	0.030	0.210	6ydhA.pdb.gz
13	PDB:4fjcE	0.068	0.067	7.527E-1	434	0.089	0.088	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:7qcdD	0.083	0.091	9.487E-1	326	0.056	0.074	7qcdD.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:5dkaA	0.075	0.257	1.129	96	0.044	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
16	PDB:4btsA9	0.057	0.177	1.196	93	0.042	0.194	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
17	PDB:6g90T	0.070	0.065	1.267	462	0.075	0.069	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:4kblA	0.077	0.082	1.343	395	0.077	0.084	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
19	PDB:6gejS	0.065	0.109	1.343	208	0.073	0.149	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:4mtdD	0.062	0.122	1.692	151	0.026	0.073	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03936	0.0	534	586	0.653	0.476	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
2	Q96JC4	4.15e-178	509	524	0.621	0.506	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
3	A6NNF4	1.98e-173	501	616	0.611	0.424	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	Q14593	2.21e-173	499	569	0.604	0.453	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
5	Q2NKJ9	6.22e-171	493	569	0.609	0.457	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
6	Q9H8G1	3.69e-169	488	570	0.609	0.456	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
7	Q15928	9.50e-167	478	474	0.597	0.538	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
8	Q8IYB9	5.73e-166	483	648	0.609	0.401	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
9	Q8TD23	6.00e-166	480	568	0.593	0.445	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
10	Q8IYX0	6.27e-166	474	411	0.574	0.596	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
11	P35789	1.88e-165	480	620	0.597	0.411	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
12	Q03923	2.92e-165	479	595	0.590	0.424	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
13	Q5JVG8	3.32e-164	471	444	0.571	0.550	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
14	Q8IW36	9.70e-163	469	515	0.574	0.476	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
15	P17038	2.34e-162	479	809	0.604	0.319	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
16	Q8IYN0	2.40e-162	469	542	0.588	0.463	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
17	O75437	2.22e-161	471	659	0.590	0.382	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
18	Q96H40	9.91e-161	462	463	0.583	0.538	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
19	Q05481	6.24e-155	470	1191	0.604	0.217	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
20	Q8NA42	1.22e-129	384	475	0.496	0.446	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12552 DUF3741	37	15.6	Protein of unknown function (DUF3741)
2	PF01352 KRAB	2.9e-21	86.1	KRAB box
3	PF00096 zf-C2H2	2.6e-29	111.1	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	5.3e-16	68.9	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	2.3e-07	41.9	C2H2-type zinc finger
6	PF13913 zf-C2HC_2	1.3e+02	13.9	zinc-finger of a C2HC-type
7	PF13465 zf-H2C2_2	1.2e-55	194.8	Zinc-finger double domain
8	PF13451 zf-trcl	5.1e+02	12.0	Probable zinc-ribbon domain
9	PF18387 zf_C2H2_ZHX	34	15.6	Zinc-fingers and homeoboxes C2H2 finger domain
10	PF18439 zf_UBZ	1.2	20.1	Ubiquitin-Binding Zinc Finger
11	PF09723 Zn-ribbon_8	0.31	22.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400852

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325313	0.672	Microtubule-associated protein 1S
2	9606.ENSP00000421142	0.620	Tripartite motif containing 60
3	9606.ENSP00000376603	0.601	Small integral membrane protein 8
4	9606.ENSP00000305699	0.539	Protein Hook homolog 3
5	9606.ENSP00000368965	0.531	Heparan-alpha-glucosaminide N-acetyltransferase
6	9606.ENSP00000281772	0.518	KAT8 regulatory NSL complex subunit 1 like
7	9606.ENSP00000321426	0.508	Olfactory receptor 52E4
8	9606.ENSP00000259963	0.501	Protein FAM8A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.989	regulation of metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0031323	0.943	regulation of cellular metabolic process
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0048523	0.933	negative regulation of cellular process
GO:0051172	0.838	negative regulation of nitrogen compound metabolic process
GO:0009987	0.828	cellular process
GO:0031324	0.807	negative regulation of cellular metabolic process
GO:0019219	0.786	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.774	regulation of biosynthetic process
GO:0010605	0.761	negative regulation of macromolecule metabolic process
GO:0031326	0.733	regulation of cellular biosynthetic process
GO:0010556	0.732	regulation of macromolecule biosynthetic process
GO:0051252	0.732	regulation of RNA metabolic process
GO:0045934	0.715	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.684	regulation of DNA-templated transcription
GO:0009890	0.659	negative regulation of biosynthetic process
GO:0008152	0.581	metabolic process
GO:0051253	0.507	negative regulation of RNA metabolic process
GO:0010558	0.475	negative regulation of macromolecule biosynthetic process
GO:0031327	0.472	negative regulation of cellular biosynthetic process
GO:1902679	0.457	negative regulation of RNA biosynthetic process
GO:0071704	0.453	organic substance metabolic process
GO:0045892	0.453	negative regulation of DNA-templated transcription
GO:0044237	0.438	cellular metabolic process
GO:0044238	0.391	primary metabolic process
GO:0006357	0.350	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.915	cytoplasm
GO:0031981	0.845	nuclear lumen
GO:0016020	0.832	membrane
GO:0005654	0.758	nucleoplasm
GO:0005829	0.567	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]