StarFunc result for job id B4DYI2

User Input

>input (1134 residues)
MENLPFPLKLLSASSLNTPSSTPWVLDIFLTLVFALGFFFLLLPYFSYLRCDNPPSPSPK
KRKRHLVSQRPAGRRGRPRGRMKNHSLRACRECPRGLEETWDLLSQLQSLLGPHLEKGDF
GQLSGPDPPGEVGKRTPDGASRSSHEPTEDAAPIVSPLASPDPRTKHPQDLASTPPPGPM
TTSVSSLSASQPPEPSLLLEHPSPEPPALFPHPPRTPDPLACSPPPPKGFTPPPLRDSTL
LTPSHCDSVALPLDTVPQSLSPREDLAASVPGISGLGGSNSQVSALSWSQETTKTWCVFN
SSVQQDHLSRQRDTTMSPLLFQAQPLSHLEPESQPFISSTPQFWPTPMAQAEAQAHLQSS
FPVLSPAFLSPMKNTGVACPASQNKVQALSLPETQHPERPLLKKQLEGGLALPSRVQKSQ
DVFSVSTPNLPQERLTSILPENFPVSPELWRQLEQHMGQRGRIQESLDLMQLQDELPGTS
QAKGKPRPWQSSTSTGESSKEAQTVKFQLERDPCPHLGQILGETPQNLSRGMESFPGKVL
GATSEESERNLRKPLRSDSGSDLLRRTERNHIENILKAHMSRKLGQTNEGLIPVSVRRSW
LAVNQAFPVSNTHVKTSNLAAPKSRKACVNTAQVLSFLEPCTQQVLGAHIVRFWAKHRWG
LPLRVLKPIQCFQLEKVSSLSLIQLAGPSSDTCESGAGSKVEVATFLGEPPMASLRKQVL
TKPSVHMPERLQASSPACKQFQRAPRGIPSSNDHGSLKAPTAGQEGRWPSKPLTYSLTGS
TQQSRSLGAQSSRAGETREAVPQPTVPLGTCMRANLQATSEDVRGFKAPGASKSSLLPRM
SVSQDPRKLCLMEEAVSEFEPGKATKSETQPQVSATVVLLPDGQASVVPHASENLASQVP
QGHLQSMPTGNMQASQELCDLMSARRSNMGHKEPRNPNCQGSCKSQSPMFPPTHKRENSR
KPNLEKHEEMFQGLRTPQLTPGRKTEDTRQNEGVQLLPSKKQPPSISHFGENIKQFFQTI
FSKKERKPAPVTAESQKTVKNRSCVYGSSAEAERLMTAVGQILEENMSLCHARHASKVNQ
QRQQFQAPVCGFPCNHRHPFYSEHSRMLSYAASSQQATLKNQSRPNRDRQIRDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IWB4	0.103	0.089	0.000	1347	0.862	0.725	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	AFDB:Q9VFH4	0.044	0.042	4.870E-4	1200	0.155	0.147	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
3	AFDB:Q57U60	0.041	0.040	1.876E-3	1172	0.164	0.159	Q57U60.pdb.gz	Q57U60_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.6H23.100 PE=4 SV=1
4	AFDB:Q96T23	0.051	0.043	2.162E-3	1441	0.131	0.103	Q96T23.pdb.gz	RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2
5	AFDB:Q21127	0.047	0.062	3.553E-3	819	0.119	0.165	Q21127.pdb.gz	MEGG2_CAEEL Protein meg-2 OS=Caenorhabditis elegans OX=6239 GN=meg-2 PE=1 SV=2
6	AFDB:A8JV11	0.045	0.043	4.396E-3	1213	0.142	0.133	A8JV11.pdb.gz	A8JV11_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=3
7	AFDB:Q63624	0.050	0.046	9.598E-3	1258	0.165	0.149	Q63624.pdb.gz	SFR19_RAT Splicing factor, arginine/serine-rich 19 OS=Rattus norvegicus OX=10116 GN=Scaf1 PE=1 SV=2
8	AFDB:Q5TC82	0.046	0.046	1.187E-2	1133	0.106	0.106	Q5TC82.pdb.gz	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
9	AFDB:Q5DTX6	0.044	0.039	1.577E-2	1320	0.168	0.145	Q5DTX6.pdb.gz	JCAD_MOUSE Junctional cadherin 5-associated protein OS=Mus musculus OX=10090 GN=Jcad PE=1 SV=2
10	AFDB:Q9DB00	0.041	0.024	1.952E-2	2260	0.168	0.085	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
11	PDB:5nrlG	0.039	0.086	2.769	372	0.020	0.062	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
12	PDB:5mrc66	0.029	0.090	5.245	305	0.010	0.036	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
13	PDB:6ahd9	0.032	0.184	5.631	165	0.012	0.085	6ahd9.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
14	PDB:7nac7	0.028	0.170	6.045	129	0.019	0.171	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IWB4	0.0	1393	1347	0.630	0.530	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
2	B6VQA5	1.45e-101	347	1048	0.261	0.282	SPT31_RAT Spermatogenesis-associated protein 31 OS=Rattus norvegicus OX=10116 GN=Spata31 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15371 DUF4599	8.5e-21	85.4	Domain of unknown function (DUF4599)
2	PF14650 FAM75	1.4e-88	309.7	FAM75 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008973981.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806584.1	0.510	Spermatogenesis-associated protein 32 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003779	0.319	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.672	regulation of biological process
GO:0009987	0.574	cellular process
GO:0032502	0.492	developmental process
GO:0032501	0.492	multicellular organismal process
GO:0008152	0.341	metabolic process
GO:0071704	0.318	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0012505	0.991	endomembrane system
GO:0031410	0.976	cytoplasmic vesicle
GO:0030141	0.947	secretory granule
GO:0001669	0.860	acrosomal vesicle
GO:0005634	0.325	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]