StarFunc result for job id B5MCY1

User Input

>input (1934 residues)
MDSTSFLPTFLDVDLTISHIKCLPKDILVKFQGIKSNECEFDYHVLQREIQHTPKVKNNV
EIDEFCLVEERVSGEWQRGRVMEKKNELYTVLLIDRGEELRVAGPQIASACGNLFELPPR
VVFGIFANILPVGEKWSPKALNYFKSLVGIQVKGYVQAILPLQMFLFEVPKIISQALELQ
LGRLVDGDSFRLIVEMLEEFPQQMPDLLQHKRPELSLGNKDTSLDIQHVLDKLQPSLSVG
STESVKVSSALSPSKFYCQLIKWTPELENLTAHMTLHYDTVCQETSPTCDNFGLLCVARR
RNGQWHRGILQQLLPPNQVKIWFMDYGSSEAIPSIYVKKLKQDFILVPLFSFPCSLTCLH
SPDRDARIFQLSIFKQALLGQVVYAHIDWFNKDECLYYVTLQTQESTVNSKCLLKTVGTQ
VLCPMSDSKISNILSETSVSDVNSFAVESFMGNIEWSIDSLNKKGILKVGFPIKTVQMEI
EAAYIAFIAYVLNPSNFWVRTNDHRNEFQEIMKNINKFYDLCENDEMILRKPEPGLFCCA
RYSKDRRFYRAVITEINGYKINVYFLDYGNTDSIPFFDVKILLPEFCELPALAMCCSLAH
IFPVEDLWTKAAIDYFKKLVLNKAILLQVIAKKDDKYTVNIQSVEASENIDVISLMLQAG
YAEYFQVELEYFPKSVSEYSMLNSESKNKVNIKKVISALLEGPKSKKYHSNNLVENNLSL
PKSLAVNISEFKNPFTLSVGPESSWPYKEYIFRPGTVLEVKCSCYYGPGDFSCQLQCKSE
DLKLLMEQIQNYYSIHSDPYEIGQTACVAKYSGKWCRAAVLTQVSKEVDIVFVDYGYQKR
VLIEDLCAINPRFLLLESQAFRCCLNHFIEPVSCKLFSWTRKAFRDLWNFISSSRGLLTC
IIYALVIIHPNHLYNLVDLQSSFTSAKEFLMNRGSAQYITLSETFPSLFSLYSYCYSSFN
IQIGSEEEVYISHIYSPQKFYCQLGRNNKDLEMIETKITESVNLQNFPKYDSNKMRVCIS
KYVEDGLSYRALAIPTDSSSEFQVYFVDFGNKQLVGENMLRAISAQFPELLFTPMQAIKC
FLSDLRDVDIPAEISSWFKDNFLGRSLKAIILSQESDGQLGIELYDGSQYINEKIKVLLH
AYGKRHCDQACCMEKSNKINENKRFTTSLKGKTGNNYRHNVINKPSPVTYSERKIDQLMH
PKNIHARFLKPSVCYKMEPVSKNKMKTSLNDGLKGIKIVPGAAHILENRRVGQKSVKVVS
QSFIRALNQTTSQNPYDLIRPQIKDLPQPQIYLNAKVKGYVSNISNPANFHIQLAENESV
IIRLADALNATARRLRERKSVKPLVGDLVVAEYSGDNAIYRAVIKKILPGNSFEVEFIDY
GNSAIVNTSKIYELQREFLTVPQLGIHAFLSGVKWNEPDEIWDDKTVDYFTSKVHNKTVY
CEFLKKHDQKWEVNMICDEKCVINELLKWKACSKLQKSALQMPQVLSQKVRPGDNEMKKG
KSNESEGSMNSNQQLFKIPLEEFKLGQLEKAEMLNVSKSGRFYVKLSKNKKILSDLIVLI
TKEEKKSPFLSMESIEKGLECLAKSKNTLKWHRSKVEEKYVDDKVLVFLVDCGIYEIVPV
CNTKLLSNEIRNIPRQAVPCKWIWFENSKNISFECLFADLEINILFLKYLDAVWEVEILV
DDLLLLEYLNLNTVPVEENKLRLAEIVYNIESKTPVSSCTIKSFTWVQFQNDRQYSGIAT
AVSDPSDFSIQLEDFFDIMKYLFMLLSDLPETLQTLPQEFIIPGSSCLFKYKSEDQWNRV
EISEVSPQSLCLVLVDYGFSFYIRYSEIINLKVVPEELLNLPRLSYPCILYGILPAKGKH
WSEEAKIFFRDFLSKPDLVFQFREYHSETKLKVDVIHEKNNLADILVASGLATYSKDSPH
LDAITATESAKNPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R237	0.213	0.196	0.000	2117	0.249	0.228	F1R237.pdb.gz	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
2	AFDB:A0A140VK49	0.100	0.188	1.435E-18	910	0.054	0.114	A0A140VK49.pdb.gz	A0A140VK49_HUMAN Staphylococcal nuclease domain-containing protein OS=Homo sapiens OX=9606 GN=SND1 PE=2 SV=1
3	AFDB:Q7ZT42	0.104	0.183	6.977E-18	897	0.053	0.115	Q7ZT42.pdb.gz	SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio OX=7955 GN=snd1 PE=2 SV=1
4	AFDB:Q5VCS6	0.105	0.192	2.747E-16	1040	0.046	0.085	Q5VCS6.pdb.gz	TDRD5_MOUSE Tudor domain-containing protein 5 OS=Mus musculus OX=10090 GN=Tdrd5 PE=1 SV=3
5	AFDB:Q9Y2W6	0.101	0.335	1.206E-15	561	0.034	0.118	Q9Y2W6.pdb.gz	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
6	AFDB:Q86BS3	0.028	0.056	4.910E-4	926	0.064	0.133	Q86BS3.pdb.gz	Q86BS3_DROME Chromator, isoform A OS=Drosophila melanogaster OX=7227 GN=Chro PE=1 SV=1
7	AFDB:Q9UQR0	0.038	0.076	4.634E-3	700	0.039	0.107	Q9UQR0.pdb.gz	SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1
8	AFDB:Q1ZXN8	0.030	0.131	4.877E-3	411	0.021	0.100	Q1ZXN8.pdb.gz	Q1ZXN8_DICDI DUF1325 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272054 PE=4 SV=1
9	AFDB:O42976	0.035	0.068	7.719E-3	764	0.039	0.099	O42976.pdb.gz	YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC20F10.07 PE=1 SV=1
10	PDB:7abi7	0.029	0.217	1.211E-2	236	0.008	0.064	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
11	PDB:6tedZ	0.042	0.101	1.563E-2	510	0.020	0.075	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
12	PDB:7okyZ	0.036	0.125	1.645E-2	374	0.018	0.091	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
13	AFDB:Q8MSF8	0.038	0.065	2.141E-2	880	0.046	0.101	Q8MSF8.pdb.gz	Q8MSF8_DROME GM15606p OS=Drosophila melanogaster OX=7227 GN=loh PE=2 SV=1
14	PDB:4v6xCA	0.036	0.173	2.883E-2	255	0.011	0.086	4v6xCA.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:4pa0B	0.027	0.054	6.521E-2	920	0.009	0.020	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
16	PDB:3mp8A	0.028	0.102	8.856E-2	513	0.010	0.039	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
17	PDB:2ns2A	0.027	0.179	9.320E-2	201	0.014	0.139	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
18	PDB:4pa0A	0.025	0.046	9.808E-2	974	0.006	0.011	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
19	PDB:7odrD	0.028	0.163	1.086E-1	240	0.006	0.050	7odrD.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
20	PDB:7qxbP	0.034	0.168	1.143E-1	251	0.016	0.120	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P61407	7.85e-161	547	2134	0.233	0.211	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
2	F1R237	2.35e-157	537	2117	0.238	0.218	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
3	Q90WE3	1.77e-80	298	1905	0.104	0.106	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
4	Q9BXT4	9.85e-30	132	1180	0.102	0.168	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
5	Q99MV1	9.84e-29	128	1172	0.082	0.136	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
6	A9CPT4	1.31e-26	121	1133	0.081	0.139	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
7	Q58EK5	1.60e-26	121	1175	0.095	0.157	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
8	Q5VCS6	2.18e-15	85.1	1040	0.029	0.055	TDRD5_MOUSE Tudor domain-containing protein 5 OS=Mus musculus OX=10090 GN=Tdrd5 PE=1 SV=3
9	P25823	5.90e-10	67.4	2515	0.046	0.035	TUD_DROME Maternal protein tudor OS=Drosophila melanogaster OX=7227 GN=tud PE=1 SV=2
10	Q9Y2W6	7.22e-10	66.2	561	0.018	0.061	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
11	Q99MV7	2.08e-08	62.4	1640	0.043	0.051	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
12	Q9R1R4	2.77e-08	61.6	1113	0.041	0.071	TDRD7_RAT Tudor domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Tdrd7 PE=1 SV=1
13	Q8K1H1	1.00e-07	59.7	1086	0.040	0.071	TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus OX=10090 GN=Tdrd7 PE=1 SV=1
14	Q14BI7	1.72e-07	59.3	1383	0.033	0.046	TDRD9_MOUSE ATP-dependent RNA helicase TDRD9 OS=Mus musculus OX=10090 GN=Tdrd9 PE=1 SV=3
15	Q8NHU6	2.94e-07	58.2	1098	0.048	0.084	TDRD7_HUMAN Tudor domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TDRD7 PE=1 SV=2
16	Q9VQ91	4.10e-07	57.4	576	0.026	0.087	TDRKH_DROME Tudor and KH domain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=papi PE=1 SV=1
17	Q80VL1	5.15e-07	57.0	560	0.017	0.059	TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus OX=10090 GN=Tdrkh PE=1 SV=1
18	Q8NDG6	5.15e-07	57.8	1382	0.024	0.033	TDRD9_HUMAN ATP-dependent RNA helicase TDRD9 OS=Homo sapiens OX=9606 GN=TDRD9 PE=2 SV=3
19	Q8VZG7	7.00e-07	57.0	991	0.025	0.049	TSN1_ARATH Ribonuclease TUDOR 1 OS=Arabidopsis thaliana OX=3702 GN=TSN1 PE=1 SV=1
20	Q9FLT0	8.13e-07	57.0	985	0.029	0.057	TSN2_ARATH Ribonuclease TUDOR 2 OS=Arabidopsis thaliana OX=3702 GN=TSN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17877 Dis3l2_C_term	1.5e+02	14.2	DIS3-like exonuclease 2 C terminal
2	PF15057 DUF4537	54	15.2	Domain of unknown function (DUF4537)
3	PF00565 SNase	0.011	27.6	Staphylococcal nuclease homologue
4	PF00567 TUDOR	4e-140	470.9	Tudor domain
5	PF18104 Tudor_2	7.6e+02	11.2	Jumonji domain-containing protein 2A Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384376

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348132	0.800	Serine/threonine kinase 31
2	9606.ENSP00000390621	0.780	Putative ATP-dependent RNA helicase TDRD12
3	9606.ENSP00000330031	0.692	Piwi-like protein 3
4	9606.ENSP00000299001	0.680	Piwi-like protein 4
5	9606.ENSP00000245255	0.610	Piwi-like protein 1
6	9606.ENSP00000360560	0.606	T-complex-associated-testis-expressed 1
7	9606.ENSP00000349208	0.575	Piwi-like protein 2
8	9606.ENSP00000333915	0.569	Cilia- and flagella-associated protein 73
9	9606.ENSP00000315035	0.562	Protein phosphatase 1 regulatory subunit 42
10	9606.ENSP00000293845	0.561	Coiled-coil domain-containing protein 42
11	9606.ENSP00000297767	0.550	Probable inactive serine protease 37
12	9606.ENSP00000357465	0.536	Tudor domain-containing protein 10
13	9606.ENSP00000262794	0.528	RNA helicase Mov10l1
14	9606.ENSP00000360913	0.523	Spermatogenesis-associated protein 6
15	9606.ENSP00000285928	0.520	Leucine-rich repeat and guanylate kinase domain-containing protein
16	9606.ENSP00000357894	0.519	Protein FAM24B
17	9606.ENSP00000387303	0.518	ATP-dependent RNA helicase TDRD9
18	9606.ENSP00000237201	0.515	Sperm acrosome membrane-associated protein 1
19	9606.ENSP00000253079	0.508	Coiled-coil domain-containing protein 62
20	9606.ENSP00000478212	0.507	A-kinase anchor protein 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.493	nucleic acid binding
GO:0003723	0.430	RNA binding
GO:0003824	0.365	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0048856	0.985	anatomical structure development
GO:0030154	0.985	cell differentiation
GO:0007276	0.980	gamete generation
GO:0003006	0.979	developmental process involved in reproduction
GO:0022412	0.972	cellular process involved in reproduction in multicellular organism
GO:0050789	0.954	regulation of biological process
GO:0007281	0.948	germ cell development
GO:0007283	0.933	spermatogenesis
GO:0043170	0.870	macromolecule metabolic process
GO:0044237	0.829	cellular metabolic process
GO:0006807	0.819	nitrogen compound metabolic process
GO:0044238	0.812	primary metabolic process
GO:0016043	0.799	cellular component organization
GO:0090304	0.718	nucleic acid metabolic process
GO:0050794	0.539	regulation of cellular process
GO:0019222	0.498	regulation of metabolic process
GO:0060255	0.474	regulation of macromolecule metabolic process
GO:0010468	0.434	regulation of gene expression
GO:0022607	0.326	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036464	0.997	cytoplasmic ribonucleoprotein granule
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005829	0.977	cytosol
GO:0043186	0.969	P granule
GO:0033391	0.832	chromatoid body
GO:0005634	0.783	nucleus
GO:0012505	0.525	endomembrane system
GO:0032991	0.485	protein-containing complex
GO:0032019	0.369	mitochondrial cloud

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]