StarFunc result for job id B5ME19

User Input

>input (914 residues)
MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEG
SSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDS
DSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKKKHDRKSKRLDEEEEEDNEGG
EWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAAQIELLQLLVQ
IAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIF
VGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQV
CAIIERVQRYLEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAEN
EGEDSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQ
HADPPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERN
QEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLR
VGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTML
VRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPT
QTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYM
RRGGYRQQQSQTAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5ME19	1.000	1.000	0.000	914	1.000	1.000	B5ME19.pdb.gz	EIFCL_HUMAN Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens OX=9606 GN=EIF3CL PE=1 SV=1
2	PDB:7qp6y	0.568	0.738	1.546E-63	697	0.759	0.996	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
3	PDB:6zp4C	0.567	0.816	4.587E-63	633	0.690	0.997	6zp4C.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
4	PDB:7qp7y	0.553	0.782	4.557E-59	642	0.699	0.995	7qp7y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
5	AFDB:O49160	0.559	0.568	1.305E-46	900	0.370	0.376	O49160.pdb.gz	EIF3C_ARATH Eukaryotic translation initiation factor 3 subunit C OS=Arabidopsis thaliana OX=3702 GN=TIF3C1 PE=1 SV=2
6	PDB:6zceq	0.487	0.682	2.306E-23	636	0.201	0.289	6zceq.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
7	AFDB:Q9VVU5	0.227	0.358	2.485E-7	525	0.081	0.141	Q9VVU5.pdb.gz	CSN1_DROME COP9 signalosome complex subunit 1b OS=Drosophila melanogaster OX=7227 GN=CSN1b PE=2 SV=1
8	AFDB:P61201	0.283	0.488	2.584E-7	443	0.069	0.142	P61201.pdb.gz	CSN2_HUMAN COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2 PE=1 SV=1
9	AFDB:P0CU17	0.239	0.414	5.198E-7	443	0.061	0.126	P0CU17.pdb.gz	RPN51_SCHPO 26S proteasome regulatory subunit rpn501 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn501 PE=1 SV=1
10	AFDB:A8K070	0.227	0.353	6.312E-7	526	0.084	0.146	A8K070.pdb.gz	A8K070_HUMAN G protein pathway suppressor 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=1
11	AFDB:Q5B3U7	0.214	0.340	7.968E-7	506	0.077	0.138	Q5B3U7.pdb.gz	CSN2_EMENI COP9 signalosome complex subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=csnB PE=1 SV=2
12	AFDB:O00232	0.227	0.363	1.006E-6	456	0.074	0.149	O00232.pdb.gz	PSD12_HUMAN 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3
13	AFDB:Q12250	0.240	0.405	1.087E-6	445	0.077	0.157	Q12250.pdb.gz	RPN5_YEAST 26S proteasome regulatory subunit RPN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN5 PE=1 SV=3
14	AFDB:P60228	0.202	0.353	2.024E-6	445	0.068	0.139	P60228.pdb.gz	EIF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1
15	PDB:6r7nB	0.204	0.350	1.049E-5	443	0.068	0.140	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
16	PDB:5l4kQ	0.275	0.504	1.432E-5	422	0.079	0.171	5l4kQ.pdb.gz
17	PDB:5l4kP	0.230	0.388	1.547E-5	456	0.074	0.149	5l4kP.pdb.gz
18	PDB:5mpbP	0.206	0.344	1.953E-5	440	0.061	0.127	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
19	PDB:6j2cS	0.212	0.349	2.564E-5	475	0.075	0.145	6j2cS.pdb.gz	Structural Snapshots of 26S Proteasome Reveal Tetraubiquitin-Induced Conformations.
20	PDB:5mpbQ	0.264	0.476	4.085E-5	434	0.073	0.154	5mpbQ.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5ME19	0.0	1901	914	1.000	1.000	EIFCL_HUMAN Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens OX=9606 GN=EIF3CL PE=1 SV=1
2	Q8R1B4	0.0	1823	911	0.966	0.969	EIF3C_MOUSE Eukaryotic translation initiation factor 3 subunit C OS=Mus musculus OX=10090 GN=Eif3c PE=1 SV=1
3	Q99613	0.0	1894	913	0.999	1.000	EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1
4	O49160	2.16e-154	479	900	0.367	0.372	EIF3C_ARATH Eukaryotic translation initiation factor 3 subunit C OS=Arabidopsis thaliana OX=3702 GN=TIF3C1 PE=1 SV=2
5	O14164	1.96e-130	416	918	0.253	0.252	EIF3C_SCHPO Eukaryotic translation initiation factor 3 subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nip1 PE=1 SV=2
6	P32497	2.92e-70	251	812	0.186	0.209	EIF3C_YEAST Eukaryotic translation initiation factor 3 subunit C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIP1 PE=1 SV=2
7	Q38AD5	1.23e-31	135	740	0.141	0.174	Q38AD5_TRYB2 Eukaryotic translation initiation factor 3 subunit 8, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2220 PE=4 SV=1
8	Q4Q055	6.18e-18	91.3	731	0.081	0.101	Q4Q055_LEIMA Putative eukaryotic translation initiation factor 3 subunit 8 OS=Leishmania major OX=5664 GN=LMJF_36_6980 PE=4 SV=1
9	Q9C5Z3	0.089	38.9	441	0.032	0.066	EIF3E_ARATH Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana OX=3702 GN=TIF3E1 PE=1 SV=1
10	Q9NDJ2	4.4	33.9	3198	0.046	0.013	DOM_DROME Helicase domino OS=Drosophila melanogaster OX=7227 GN=dom PE=1 SV=2
11	F4I420	7.0	33.1	1294	0.027	0.019	F4I420_ARATH Eukaryotic translation initiation factor 5B OS=Arabidopsis thaliana OX=3702 GN=EIF5B1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05470 eIF-3c_N	1.5e-269	907.1	Eukaryotic translation initiation factor 3 subunit 8 N-terminus
2	PF01399 PCI	1.4e-13	62.6	PCI domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220849	0.999	Eukaryotic translation initiation factor 3 subunit E
2	9606.ENSP00000358140	0.999	Eukaryotic translation initiation factor 3 subunit A
3	9606.ENSP00000431800	0.999	Eukaryotic translation initiation factor 3 subunit F
4	9606.ENSP00000436049	0.999	Eukaryotic translation initiation factor 3 subunit M
5	9606.ENSP00000485663	0.999	Eukaryotic translation initiation factor 3 subunit L
6	9606.ENSP00000354125	0.998	Eukaryotic translation initiation factor 3 subunit B
7	9606.ENSP00000216190	0.997	Eukaryotic translation initiation factor 3 subunit D
8	9606.ENSP00000429931	0.997	Eukaryotic translation initiation factor 3 subunit H
9	9606.ENSP00000248342	0.996	Eukaryotic translation initiation factor 3 subunit K
10	9606.ENSP00000253108	0.996	Eukaryotic translation initiation factor 3 subunit G
11	9606.ENSP00000362688	0.996	Eukaryotic translation initiation factor 3 subunit I
12	9606.ENSP00000216554	0.964	Eukaryotic translation initiation factor 5
13	9606.ENSP00000364119	0.955	Eukaryotic translation initiation factor 2 subunit 2
14	9606.ENSP00000261868	0.950	Eukaryotic translation initiation factor 3 subunit J
15	9606.ENSP00000256383	0.947	Eukaryotic translation initiation factor 2 subunit 1
16	9606.ENSP00000232905	0.945	Eukaryotic translation initiation factor 1b
17	9606.ENSP00000289371	0.937	Eukaryotic translation initiation factor 5B
18	9606.ENSP00000296577	0.936	ATP-binding cassette sub-family E member 1
19	9606.ENSP00000253039	0.932	Eukaryotic translation initiation factor 2 subunit 3
20	9606.ENSP00000419449	0.928	Eukaryotic translation initiation factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003743	1.000	translation initiation factor activity
GO:0003723	0.995	RNA binding
GO:0044877	0.898	protein-containing complex binding
GO:0043021	0.884	ribonucleoprotein complex binding
GO:0043022	0.854	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0034641	0.990	cellular nitrogen compound metabolic process
GO:0010467	0.988	gene expression
GO:0019538	0.977	protein metabolic process
GO:0044260	0.976	cellular macromolecule metabolic process
GO:1901576	0.971	organic substance biosynthetic process
GO:0044249	0.971	cellular biosynthetic process
GO:0009059	0.953	macromolecule biosynthetic process
GO:0044271	0.950	cellular nitrogen compound biosynthetic process
GO:1901566	0.928	organonitrogen compound biosynthetic process
GO:0034645	0.926	cellular macromolecule biosynthetic process
GO:0006412	0.909	translation
GO:0065007	0.829	biological regulation
GO:0050789	0.735	regulation of biological process
GO:0050794	0.714	regulation of cellular process
GO:0006413	0.709	translational initiation
GO:0051171	0.694	regulation of nitrogen compound metabolic process
GO:0031323	0.693	regulation of cellular metabolic process
GO:0080090	0.691	regulation of primary metabolic process
GO:0060255	0.691	regulation of macromolecule metabolic process
GO:0048518	0.643	positive regulation of biological process
GO:0010468	0.590	regulation of gene expression
GO:0048522	0.580	positive regulation of cellular process
GO:0009889	0.573	regulation of biosynthetic process
GO:0031326	0.544	regulation of cellular biosynthetic process
GO:0010556	0.534	regulation of macromolecule biosynthetic process
GO:0051246	0.460	regulation of protein metabolic process
GO:0010604	0.336	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005852	0.996	eukaryotic translation initiation factor 3 complex
GO:0005829	0.992	cytosol
GO:0043231	0.663	intracellular membrane-bounded organelle
GO:0005634	0.628	nucleus
GO:0043232	0.595	intracellular non-membrane-bounded organelle
GO:0031981	0.592	nuclear lumen
GO:0005654	0.524	nucleoplasm
GO:0016020	0.503	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]