StarFunc result for job id B6A8C7

User Input

>input (271 residues)
MIPKLLSLLCFRLCVGQGDTRGDGSLPKPSLSAWPSSVVPANSNVTLRCWTPARGVSFVL
RKGGIILESPKPLDSTEGAAEFHLNNLKVRNAGEYTCEYYRKASPHILSQRSDVLLLLVT
GHLSKPFLRTYQRGTVTAGGRVTLQCQKRDQLFVPIMFALLKAGTPSPIQLQSPAGKEID
FSLVDVTAGDAGNYSCMYYQTKSPFWASEPSDQLEILVTVPPGTTSSNYSLGNFVRLGLA
AVIVVIMGAFLVEAWYSRNVSPGESEAFKPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B6A8C7	1.000	1.000	2.019E-51	271	1.000	1.000	B6A8C7.pdb.gz	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
2	AFDB:B6A8R8	0.727	0.686	1.751E-32	288	0.506	0.476	B6A8R8.pdb.gz	TARM1_MOUSE T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Mus musculus OX=10090 GN=Tarm1 PE=2 SV=1
3	AFDB:Q8VBT3	0.376	0.382	5.614E-21	265	0.321	0.328	Q8VBT3.pdb.gz	OSCAR_MOUSE Osteoclast-associated immunoglobulin-like receptor OS=Mus musculus OX=10090 GN=Oscar PE=2 SV=1
4	AFDB:Q9HCN6	0.587	0.476	6.272E-20	339	0.358	0.286	Q9HCN6.pdb.gz	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
5	AFDB:Q8C567	0.565	0.481	1.147E-19	325	0.306	0.255	Q8C567.pdb.gz	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
6	AFDB:P0C191	0.575	0.503	1.985E-19	313	0.317	0.275	P0C191.pdb.gz	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
7	AFDB:Q8NHJ6	0.579	0.364	2.097E-19	448	0.314	0.190	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
8	AFDB:A6NI73	0.555	0.508	5.327E-19	299	0.303	0.274	A6NI73.pdb.gz	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
9	AFDB:P24071	0.609	0.578	7.403E-19	287	0.299	0.282	P24071.pdb.gz	FCAR_HUMAN Immunoglobulin alpha Fc receptor OS=Homo sapiens OX=9606 GN=FCAR PE=1 SV=1
10	AFDB:Q28109	0.605	0.620	7.820E-19	264	0.310	0.318	Q28109.pdb.gz	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
11	PDB:5c6wJ	0.298	0.329	2.622E-7	238	0.122	0.139	5c6wJ.pdb.gz
12	PDB:5oj2B	0.280	0.148	3.850E-7	692	0.148	0.058	5oj2B.pdb.gz
13	PDB:6dlfA	0.265	0.300	5.350E-7	236	0.129	0.148	6dlfA.pdb.gz
14	PDB:6dldD	0.233	0.235	1.359E-6	269	0.140	0.141	6dldD.pdb.gz
15	PDB:1cf8L	0.261	0.315	1.788E-6	215	0.096	0.121	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
16	PDB:1otsD	0.266	0.324	2.353E-6	211	0.096	0.123	1otsD.pdb.gz	Gating the Selectivity Filter in ClC Chloride Channels
17	PDB:1f11A	0.279	0.336	2.625E-6	216	0.092	0.116	1f11A.pdb.gz
18	PDB:1fdlL	0.268	0.325	2.773E-6	214	0.096	0.121	1fdlL.pdb.gz
19	PDB:6dcvA	0.266	0.315	2.930E-6	220	0.107	0.132	6dcvA.pdb.gz
20	PDB:7u7nC	0.222	0.276	3.095E-6	200	0.103	0.140	7u7nC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B6A8C7	0.0	557	271	1.000	1.000	TARM1_HUMAN T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Homo sapiens OX=9606 GN=TARM1 PE=1 SV=2
2	B6A8R8	1.77e-80	246	288	0.472	0.444	TARM1_MOUSE T-cell-interacting, activating receptor on myeloid cells protein 1 OS=Mus musculus OX=10090 GN=Tarm1 PE=2 SV=1
3	Q8N6C5	9.04e-32	125	1336	0.321	0.065	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3
4	Q9HCN6	3.77e-31	120	339	0.365	0.292	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
5	Q925N6	1.08e-29	120	1320	0.303	0.062	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
6	Q8VBT3	2.40e-29	113	265	0.303	0.309	OSCAR_MOUSE Osteoclast-associated immunoglobulin-like receptor OS=Mus musculus OX=10090 GN=Oscar PE=2 SV=1
7	Q28109	9.76e-26	103	264	0.317	0.326	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
8	O75022	1.57e-23	101	631	0.292	0.125	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	A6NI73	4.25e-23	97.8	299	0.325	0.294	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
10	Q8NHJ6	1.89e-22	97.8	448	0.299	0.181	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
11	Q8C567	5.24e-21	92.4	325	0.314	0.262	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
12	Q8IYS5	8.96e-21	91.3	282	0.266	0.255	OSCAR_HUMAN Osteoclast-associated immunoglobulin-like receptor OS=Homo sapiens OX=9606 GN=OSCAR PE=1 SV=3
13	P0C191	9.91e-21	91.7	313	0.343	0.297	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
14	Q8N149	3.29e-20	91.7	483	0.280	0.157	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
15	O75023	3.38e-20	92.0	590	0.284	0.131	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
16	P43629	6.17e-20	90.9	444	0.292	0.178	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
17	Q8N423	6.73e-20	91.3	597	0.273	0.124	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
18	O76036	1.60e-19	88.2	304	0.310	0.276	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
19	Q14943	2.39e-19	88.6	382	0.266	0.188	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
20	P24071	8.48e-19	85.9	287	0.314	0.296	FCAR_HUMAN Immunoglobulin alpha Fc receptor OS=Homo sapiens OX=9606 GN=FCAR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	3.2	19.2	Immunoglobulin I-set domain
2	PF00047 ig	6.7e-08	43.9	Immunoglobulin domain
3	PF13895 Ig_2	1.7e-13	62.0	Immunoglobulin domain
4	PF13927 Ig_3	2.8e-08	45.5	Immunoglobulin domain
5	PF07686 V-set	2.2	19.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297873	0.583	Methyltransferase-like protein 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.996	signaling receptor binding
GO:0034987	0.991	immunoglobulin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050866	0.990	negative regulation of cell activation
GO:0050863	0.989	regulation of T cell activation
GO:1903038	0.989	negative regulation of leukocyte cell-cell adhesion
GO:0046634	0.944	regulation of alpha-beta T cell activation
GO:0050868	0.940	negative regulation of T cell activation
GO:0046636	0.909	negative regulation of alpha-beta T cell activation
GO:0009987	0.882	cellular process
GO:2000514	0.494	regulation of CD4-positive, alpha-beta T cell activation
GO:0019222	0.448	regulation of metabolic process
GO:0048518	0.444	positive regulation of biological process
GO:0010468	0.431	regulation of gene expression
GO:0050896	0.371	response to stimulus
GO:0048522	0.356	positive regulation of cellular process
GO:0080090	0.303	regulation of primary metabolic process
GO:0007154	0.300	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0071944	0.997	cell periphery
GO:0005886	0.987	plasma membrane
GO:0012505	0.920	endomembrane system
GO:0031090	0.780	organelle membrane
GO:0031982	0.745	vesicle
GO:0031410	0.703	cytoplasmic vesicle
GO:0030659	0.629	cytoplasmic vesicle membrane
GO:0098588	0.611	bounding membrane of organelle
GO:0099503	0.606	secretory vesicle
GO:0030141	0.604	secretory granule
GO:0030667	0.533	secretory granule membrane
GO:0070820	0.529	tertiary granule
GO:0070013	0.520	intracellular organelle lumen
GO:0005634	0.365	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]