StarFunc result for job id B7Z6K7

User Input

>input (855 residues)
MAAAATLRLSAQGTVTFEDVAVNFTWEEWNLLSEAQRCLYRDVTLENLALISSLGCWCGV
EDEAAPSKQSIYIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLH
RCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFL
PRSGLLQQEASHTGEKSNSKTECVSPIQCGGAHYSCGESMKHFSTKHILSQHQRLLTREE
CYVCCECGKSFSKYASLSNHQRVHTEKKHECGECGKSFSKYVSFSNHQRVHTEKKHECGE
CGKSFSKYVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTEKKHYECGECGKS
FSKYVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTDKKHYECGECGKSFSQK
SSLIQHQRFHTGEKPYGCEECGKSFSSEGHLRSHQRVHAGERPFKCGECVKSFSHKRSLV
HHQRVHSGERPYQCGECGKSFSQKGNLVLHQRVHTGARPYECGECGKSFSSKGHLRNHQQ
IHTGDRLYECGECGKSFSHKGTLILHQRVHPRERSYGCGECGKSFSSIGHLRSHQRVHTG
ERPYECGECGKSFSHKRSLVHHQRMHTGERPYKCGDCGKSFNEKGHLRNHQRVHTTERPF
KCGECGKCFSHKGNLILHQHGHTGERPYVCRECGKLFKKKSHLLVHQRIHNGEKPYACEA
CQKFFRNKYQLIAHQRVHTGERPYECNDCGKSFTHSSTFCVHKRIHTGEKPYECSECGKS
FAESSSFTKHKRVHTGEKPYECSECGKSFAESSSLTKHKRVHTGEKPYKCEKCGKLFNKK
SHLLVHQSSHWRKAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF45	0.233	0.287	2.245E-76	676	0.559	0.707	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
2	AFDB:A0A1B0GR71	0.309	0.282	1.174E-70	966	0.385	0.341	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
3	AFDB:Q05481	0.367	0.284	4.157E-69	1191	0.413	0.296	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
4	AFDB:Q62788	0.310	0.350	8.360E-66	744	0.365	0.419	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
5	AFDB:P17038	0.302	0.314	2.387E-65	809	0.371	0.392	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
6	AFDB:A6NNF4	0.327	0.362	3.485E-63	738	0.373	0.432	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
7	AFDB:Q9Y3M9	0.377	0.413	7.655E-63	751	0.339	0.386	Q9Y3M9.pdb.gz	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
8	AFDB:Q9Y2P7	0.308	0.401	2.587E-60	627	0.409	0.558	Q9Y2P7.pdb.gz	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
9	AFDB:P15620	0.265	0.379	5.714E-59	580	0.327	0.483	P15620.pdb.gz	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
10	AFDB:Q8IYB9	0.306	0.380	3.777E-58	648	0.333	0.440	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
11	PDB:3w5kB	0.063	0.268	6.045E-4	110	0.046	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6lsr0	0.038	0.116	1.039	190	0.036	0.163	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
13	PDB:7o4iW	0.031	0.070	1.095	312	0.028	0.077	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:6hiwDB	0.048	0.040	1.350	1111	0.067	0.051	6hiwDB.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7ena4	0.061	0.078	2.054	457	0.056	0.105	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:5c8dE	0.048	0.111	2.405	280	0.023	0.071	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
17	PDB:5oqj2	0.053	0.087	2.534	395	0.032	0.068	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:1pgjA	0.059	0.087	2.814	478	0.037	0.067	1pgjA.pdb.gz
19	PDB:2xv4S	0.053	0.087	2.966	399	0.060	0.128	2xv4S.pdb.gz
20	PDB:7evoC	0.058	0.089	3.294	422	0.056	0.114	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQ46	542	609	0.301	0.422	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
2	A0A1B0GR71	560	966	0.401	0.355	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
3	A0A8I6G8Y2	539	723	0.319	0.378	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
4	G3V9G6	540	740	0.319	0.369	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
5	P15620	542	580	0.304	0.448	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
6	P17021	602	662	0.377	0.486	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
7	P17038	581	809	0.333	0.352	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
8	P51523	547	738	0.340	0.394	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	P51814	545	821	0.308	0.320	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
10	Q05481	601	1191	0.365	0.262	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
11	Q06732	580	778	0.401	0.441	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
12	Q14587	656	947	0.396	0.358	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
13	Q3V1X2	586	888	0.411	0.395	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
14	Q5DTF8	590	919	0.413	0.384	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
15	Q5MCW4	566	686	0.310	0.386	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
16	Q5TYW1	571	1059	0.364	0.294	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
17	Q62788	540	744	0.319	0.367	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
18	Q68DI1	570	518	0.359	0.593	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
19	Q6ECI4	541	717	0.312	0.372	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
20	Q6ZR52	548	646	0.320	0.424	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	5.1e+02	12.0	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF01352 KRAB	3.6e-17	73.0	KRAB box
3	PF15637 Tox-HNH-HHH	4.3e+02	12.6	HNH/Endo VII superfamily nuclease toxin with a HHH motif
4	PF00096 zf-C2H2	3.5e-111	369.0	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	0.0026	28.8	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	1.4e-60	207.7	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	3.2e-12	57.4	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	6e-14	63.1	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	1.6e-130	431.6	Zinc-finger double domain
10	PF12874 zf-met	3.4	19.4	Zinc-finger of C2H2 type
11	PF18439 zf_UBZ	5.7e-07	40.4	Ubiquitin-Binding Zinc Finger
12	PF17032 zinc_ribbon_15	0.03	26.4	zinc-ribbon family
13	PF09723 Zn-ribbon_8	4.2e-11	54.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327796	0.595	DDB1- and CUL4-associated factor 4-like protein 1
2	9606.ENSP00000355251	0.565	Zinc finger protein 511

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.988	regulation of primary metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0051252	0.955	regulation of RNA metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0009890	0.950	negative regulation of biosynthetic process
GO:0051253	0.950	negative regulation of RNA metabolic process
GO:0006355	0.926	regulation of DNA-templated transcription
GO:0045892	0.924	negative regulation of DNA-templated transcription
GO:0009987	0.494	cellular process
GO:0000122	0.423	negative regulation of transcription by RNA polymerase II
GO:0032502	0.301	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.936	nucleoplasm
GO:0005737	0.823	cytoplasm
GO:0043228	0.355	non-membrane-bounded organelle
GO:0043232	0.352	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]