StarFunc result for job id B7ZBB8

User Input

>input (358 residues)
MEPIGARLSLEAPGPAPFREAPPAEELPAPVVPCVQGGGDGGGASETPSPDAQLGDRPLS
PKEEAAPQEQEELLECRRRCRARSFSLPADPILQAAKFLQQQQQQAVALGGEGAEDAQLG
PGGCCAKCKKRVQFADTLGLSLASVKHFSEAEEPQVPPAVLSRLRSFPMRAEDLEQLGGL
LAAAAVAAPLSAPPSRLRPLFQLPGPSAAAERLQRQRVCLERVQCSTASGAEVKGSGRVL
SCPGPRAVTVRYTFTEWRSFLDVPAELQPEPLEPQQPEAPSGASEPGSGDAKKEPGAECF
HFSLCLPPGLQPEDEEDADERGVAVHFAVCYRCAQGEYWDNNAGANYTLRYARPADAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CW07	0.518	0.533	1.592E-37	347	0.662	0.683	Q9CW07.pdb.gz	PP13G_MOUSE Protein phosphatase 1 regulatory subunit 3G OS=Mus musculus OX=10090 GN=Ppp1r3g PE=1 SV=2
2	AFDB:Q9VVY3	0.330	0.180	4.750E-12	681	0.204	0.107	Q9VVY3.pdb.gz	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
3	AFDB:Q99MR9	0.340	0.117	1.084E-10	1089	0.212	0.070	Q99MR9.pdb.gz	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
4	AFDB:Q00756	0.345	0.117	9.212E-10	1109	0.190	0.061	Q00756.pdb.gz	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
5	AFDB:P28006	0.277	0.135	5.068E-7	793	0.142	0.064	P28006.pdb.gz	GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2
6	PDB:7p2pB	0.090	0.130	1.788E-2	179	0.070	0.140	7p2pB.pdb.gz
7	PDB:7vt9A	0.189	0.118	2.226E-2	604	0.036	0.022	7vt9A.pdb.gz
8	PDB:1j0hA	0.193	0.123	2.773E-2	588	0.031	0.019	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
9	AFDB:Q86TB3	0.149	0.032	2.958E-2	2170	0.148	0.024	Q86TB3.pdb.gz	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
10	AFDB:Q9UBF9	0.122	0.093	3.124E-2	498	0.140	0.100	Q9UBF9.pdb.gz	MYOTI_HUMAN Myotilin OS=Homo sapiens OX=9606 GN=MYOT PE=1 SV=2
11	PDB:5kwyC	0.171	0.360	3.453E-2	133	0.045	0.120	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
12	PDB:1ogpA	0.184	0.171	3.854E-2	388	0.039	0.036	1ogpA.pdb.gz	The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
13	PDB:2ag2A	0.182	0.332	4.301E-2	164	0.034	0.073	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
14	PDB:1xl6A	0.143	0.168	5.071E-2	291	0.056	0.069	1xl6A.pdb.gz
15	PDB:5f0jB	0.149	0.167	6.315E-2	306	0.039	0.046	5f0jB.pdb.gz
16	AFDB:Q9JIF9	0.119	0.091	6.376E-2	496	0.134	0.097	Q9JIF9.pdb.gz	MYOTI_MOUSE Myotilin OS=Mus musculus OX=10090 GN=Myot PE=1 SV=1
17	PDB:5j6hA	0.150	0.185	6.671E-2	275	0.059	0.076	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
18	PDB:2agcA	0.173	0.315	7.445E-2	162	0.042	0.093	2agcA.pdb.gz
19	AFDB:A0A0P0XCU3	0.173	0.046	1.712E-1	1875	0.106	0.020	A0A0P0XCU3.pdb.gz	SSY3A_ORYSJ Soluble starch synthase 3a, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SSIIIA PE=1 SV=2
20	AFDB:Q29R48	0.147	0.082	2.514E-1	786	0.159	0.073	Q29R48.pdb.gz	Q29R48_DROME Protostome-specific GEF, isoform B OS=Drosophila melanogaster OX=7227 GN=PsGEF PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9CW07	1.50e-146	419	347	0.645	0.666	PP13G_MOUSE Protein phosphatase 1 regulatory subunit 3G OS=Mus musculus OX=10090 GN=Ppp1r3g PE=1 SV=2
2	O95685	1.61e-23	100	299	0.265	0.318	PPR3D_HUMAN Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1
3	D3ZZ26	2.36e-23	100	279	0.223	0.287	D3ZZ26_RAT Protein phosphatase 1, regulatory subunit 3D OS=Rattus norvegicus OX=10116 GN=Ppp1r3d PE=1 SV=1
4	Q8C767	9.55e-20	90.1	284	0.193	0.243	PPR3B_MOUSE Protein phosphatase 1 regulatory subunit 3B OS=Mus musculus OX=10090 GN=Ppp1r3b PE=1 SV=1
5	Q6IN01	2.41e-19	89.0	284	0.193	0.243	PPR3B_RAT Protein phosphatase 1 regulatory subunit 3B OS=Rattus norvegicus OX=10116 GN=Ppp1r3b PE=1 SV=1
6	Q86XI6	4.35e-16	79.7	285	0.182	0.228	PPR3B_HUMAN Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
7	Q9VVY3	3.76e-13	72.8	681	0.187	0.098	GBS76_DROME Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
8	P0C7L8	1.27e-12	69.7	279	0.223	0.287	PPR3E_RAT Protein phosphatase 1 regulatory subunit 3E OS=Rattus norvegicus OX=10116 GN=Ppp1r3e PE=2 SV=1
9	Q6NX94	1.93e-12	68.6	253	0.184	0.261	Q6NX94_DANRE Protein phosphatase 1 regulatory subunit OS=Danio rerio OX=7955 GN=fj66e08 PE=2 SV=1
10	Q5U2R5	5.13e-12	68.2	317	0.170	0.192	PPR3C_RAT Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
11	Q99MR9	4.03e-11	67.0	1089	0.173	0.057	PPR3A_MOUSE Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2
12	Q9UQK1	5.05e-11	65.1	317	0.187	0.211	PPR3C_HUMAN Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
13	Q8SWT8	8.92e-11	64.7	330	0.168	0.182	Q8SWT8_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
14	Q9VUF3	1.17e-10	64.7	384	0.168	0.156	Q9VUF3_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=4 SV=1
15	Q8SXW5	4.90e-10	62.8	384	0.165	0.154	Q8SXW5_DROME Protein phosphatase 1 regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Gbs-70E PE=2 SV=1
16	Q7TMB3	1.34e-09	60.8	317	0.165	0.186	PPR3C_MOUSE Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
17	Q00756	4.71e-09	60.5	1109	0.162	0.052	PPR3A_RABIT Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1
18	T1SFR8	7.38e-08	55.5	285	0.154	0.193	PPR3C_CLABA Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
19	Q6ZSY5	1.62e-04	45.8	799	0.168	0.075	PPR3F_HUMAN Protein phosphatase 1 regulatory subunit 3F OS=Homo sapiens OX=9606 GN=PPP1R3F PE=1 SV=3
20	P40036	0.006	40.8	548	0.084	0.055	GIP2_YEAST GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16760 CBM53	0.0015	30.5	Starch/carbohydrate-binding module (family 53)
2	PF03370 CBM_21	1.1e-21	88.4	Carbohydrate/starch-binding module (family 21)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393832

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341779	0.755	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
2	9606.ENSP00000326031	0.707	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000284601	0.663	Protein phosphatase 1 regulatory subunit 3A
4	9606.ENSP00000238994	0.660	Protein phosphatase 1 regulatory subunit 3C
5	9606.ENSP00000408288	0.656	Protein phosphatase 1 regulatory subunit 3E
6	9606.ENSP00000378769	0.653	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
7	9606.ENSP00000308318	0.648	Protein phosphatase 1 regulatory subunit 3B
8	9606.ENSP00000055335	0.647	Protein phosphatase 1 regulatory subunit 3F
9	9606.ENSP00000369419	0.624	Metalloreductase STEAP4
10	9606.ENSP00000360035	0.623	Protein phosphatase 1 regulatory subunit 3D
11	9606.ENSP00000263702	0.620	Enoyl-[acyl-carrier-protein] reductase, mitochondrial
12	9606.ENSP00000221138	0.613	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
13	9606.ENSP00000378306	0.613	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
14	9606.ENSP00000378323	0.613	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
15	9606.ENSP00000380878	0.613	Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
16	9606.ENSP00000418447	0.613	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
17	9606.ENSP00000377036	0.573	Serine/threonine-protein phosphatase 2A activator
18	9606.ENSP00000356156	0.571	Protein phosphatase 1 regulatory subunit 15B
19	9606.ENSP00000325074	0.561	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
20	9606.ENSP00000335083	0.561	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030247	1.000	polysaccharide binding
GO:0019903	1.000	protein phosphatase binding
GO:2001069	0.979	glycogen binding
GO:0003824	0.829	catalytic activity
GO:0016787	0.794	hydrolase activity
GO:0016788	0.769	hydrolase activity, acting on ester bonds
GO:0140096	0.710	catalytic activity, acting on a protein
GO:0042578	0.694	phosphoric ester hydrolase activity
GO:0016791	0.627	phosphatase activity
GO:0004721	0.615	phosphoprotein phosphatase activity
GO:0098772	0.471	molecular function regulator activity
GO:0030234	0.447	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0070873	0.969	regulation of glycogen metabolic process
GO:0005979	0.962	regulation of glycogen biosynthetic process
GO:0043170	0.961	macromolecule metabolic process
GO:0048522	0.872	positive regulation of cellular process
GO:0009893	0.838	positive regulation of metabolic process
GO:0031325	0.804	positive regulation of cellular metabolic process
GO:0044262	0.690	cellular carbohydrate metabolic process
GO:0044264	0.679	cellular polysaccharide metabolic process
GO:0010604	0.576	positive regulation of macromolecule metabolic process
GO:0010907	0.556	positive regulation of glucose metabolic process
GO:0009058	0.382	biosynthetic process
GO:0065009	0.359	regulation of molecular function
GO:0005977	0.346	glycogen metabolic process
GO:0009250	0.303	glucan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.744	intracellular organelle
GO:0070013	0.515	intracellular organelle lumen
GO:0005634	0.494	nucleus
GO:0032991	0.425	protein-containing complex
GO:0005829	0.411	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.794	Hydrolases.
EC:3.1.-.-	0.769	Acting on ester bonds.
EC:3.1.3.-	0.627	Phosphoric monoester hydrolases.

[back to server]