StarFunc result for job id B7ZC32

User Input

>input (967 residues)
MPTQSVDSVKAVRVRPFSQREKNSGSKCVISMHSRTTTTTQDPKNPEHVKTFTFDLAYWS
HNGFQRDKDGVLISADPSRKFAGQRDVFHDLGRGILDSAWQGYNATLLAYGQTGSGKSYS
MIGFGCKQGIIPTVCEELFRAIENQGRNQEHQVMFSMLEIYKEIIRDLLSRTKKPGGLRI
REDQQLGFYVEGLKSVPCENYAQIERLMEQGTKIRTTASTNMNASSSRSHLVITIQFKQV
FLDRDLTKQSSINLVDLARSERQKSSGSEGDRLREGSCVNLSLTNLGSVISVLADAAMGK
KVLHIPYRDSVLTKLLQSALGGNSRTALVAAVSPADICYEETLSTLRYAERERKIRNRAV
ANTWTLMRKSRAENSKLLPMMTFPHLLNLSEDPQLTRVLKYFIQAGTQPAPCPRPALSPP
HPALRISDKHASFTNADGKVTVTPHSKCKVAVNGVPITTRTKLQHLDRLILGSNSTYLYV
GFPSEWGSEDLSRFDYDFFQLERAAAEGASADKLGAADGGDGKAGPSVLAAFQDYIKLMP
LVSEANQMSEEPKKGLNMELKVKNLASSDSRGYDLQKEVLVKVTHHGSHEVWIWSKAKFI
NRKFLMQELYQRFLDGDHGPVARDDDPFWDPVEVVRLGSAHIWLQSLAYCMKLEEQVEFL
NCDGLEEAVLHTCIAPCSPTGQTHGEEDVVIDPLELLGKRMDFQIHIVRCLGVNWMKEDA
KRGTQIGYRIYDLPNTIYTKPVWKSVNPQIEETVQFAALTASQEFLNYLRTNALIVDLWG
LQEGCTELSCSQLGLMVTGEGHILVDTKKISTVKDISQAASNQIPELYLKLLKLEQETEP
LRNINRALREENVLLKASLAKTASGQAPKPSNTLKISGMTAQLPSAGEMSQMCTQQAGSD
RELAKALKVFYQSMNTARGQLFRLRRHQPPEVDQMLRPFIHQRSQMFKDLGDLRESSLWT
LKMTLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8WLE0	0.510	0.481	0.000	1034	0.724	0.677	F8WLE0.pdb.gz	KIF28_RAT Kinesin-like protein KIF28P OS=Rattus norvegicus OX=10116 GN=Kif28p PE=2 SV=1
2	AFDB:G5EFQ4	0.385	0.399	3.044E-85	928	0.339	0.353	G5EFQ4.pdb.gz	G5EFQ4_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-6 PE=1 SV=1
3	PDB:7wrgA	0.365	0.424	1.400E-78	812	0.316	0.377	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
4	PDB:7wrgB	0.351	0.420	1.011E-73	783	0.308	0.381	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
5	AFDB:Q9NGQ2	0.349	0.156	2.020E-67	2205	0.291	0.127	Q9NGQ2.pdb.gz	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
6	AFDB:Q9EQW7	0.341	0.199	1.436E-66	1749	0.281	0.156	Q9EQW7.pdb.gz	KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus OX=10090 GN=Kif13a PE=1 SV=1
7	AFDB:Q8MQ20	0.341	0.211	5.128E-66	1576	0.275	0.169	Q8MQ20.pdb.gz	Q8MQ20_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=klp-4 PE=1 SV=2
8	AFDB:P23678	0.344	0.211	5.701E-66	1584	0.280	0.171	P23678.pdb.gz	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
9	AFDB:Q9NQT8	0.335	0.181	9.688E-66	1826	0.277	0.147	Q9NQT8.pdb.gz	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
10	AFDB:F1M4A4	0.341	0.196	1.646E-65	1707	0.296	0.168	F1M4A4.pdb.gz	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
11	AFDB:Q9H1H9	0.343	0.194	2.516E-65	1805	0.284	0.152	Q9H1H9.pdb.gz	KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2
12	AFDB:A0A0G2K8Z9	0.352	0.194	6.196E-65	1843	0.280	0.147	A0A0G2K8Z9.pdb.gz	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
13	PDB:4h1gA	0.281	0.399	1.919E-22	670	0.098	0.142	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:2kb3A	0.091	0.511	1.946E-4	143	0.024	0.161	2kb3A.pdb.gz
15	PDB:2ff4A	0.085	0.205	3.066E-3	379	0.027	0.069	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
16	PDB:3es6A	0.063	0.146	3.790E-3	277	0.038	0.134	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
17	PDB:7tvzE	0.056	0.070	1.860E-2	665	0.068	0.099	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
18	PDB:6xt9A	0.049	0.069	1.961E-2	567	0.062	0.106	6xt9A.pdb.gz
19	PDB:4pa0A	0.098	0.098	3.907E-2	974	0.105	0.105	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
20	PDB:4j1xC	0.041	0.117	4.120E-2	195	0.016	0.077	4j1xC.pdb.gz	Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8WLE0	0.0	1415	1034	0.735	0.688	KIF28_RAT Kinesin-like protein KIF28P OS=Rattus norvegicus OX=10116 GN=Kif28p PE=2 SV=1
2	G5EFQ4	2.59e-161	499	928	0.337	0.351	G5EFQ4_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-6 PE=1 SV=1
3	Q9NGQ2	3.67e-98	342	2205	0.186	0.082	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
4	F1QJ64	2.29e-95	328	1161	0.202	0.168	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
5	O43896	7.46e-94	323	1103	0.193	0.170	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
6	E9QDE5	1.34e-93	328	1763	0.204	0.112	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
7	F1QBV5	1.71e-93	328	1770	0.204	0.111	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
8	O35071	8.26e-93	320	1100	0.191	0.168	KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2
9	Q5AVY3	3.85e-90	318	1630	0.183	0.109	Q5AVY3_EMENI Kinesin family protein (AFU_orthologue AFUA_2G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=uncA PE=3 SV=1
10	O35787	9.35e-90	311	1097	0.190	0.168	KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus OX=10116 GN=Kif1c PE=1 SV=1
11	Q12756	2.48e-88	312	1690	0.195	0.112	KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2
12	F1M4A4	3.09e-88	312	1707	0.200	0.113	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
13	A0A8I6A6V5	4.10e-88	311	1697	0.194	0.111	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
14	O60333	4.67e-88	311	1816	0.196	0.105	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
15	O88658	5.88e-88	311	1816	0.196	0.105	KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus OX=10116 GN=Kif1b PE=1 SV=2
16	P33173	6.83e-88	311	1695	0.194	0.111	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2
17	Q60575	7.15e-88	311	1816	0.196	0.105	KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus OX=10090 GN=Kif1b PE=1 SV=2
18	A0A0B4LGK5	2.62e-86	306	1913	0.186	0.094	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
19	O01349	2.72e-86	306	1921	0.186	0.094	O01349_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=2 SV=1
20	A4UZI0	3.07e-86	306	1899	0.186	0.095	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11618 C2-C2_1	1.8e+02	13.6	First C2 domain of RPGR-interacting protein 1
2	PF11871 DUF3391	4.5e+02	12.8	Domain of unknown function (DUF3391)
3	PF12423 KIF1B	0.0058	28.2	Kinesin protein 1B
4	PF00225 Kinesin	5.3e-94	326.5	Kinesin motor domain
5	PF16183 Kinesin_assoc	1.2e+02	14.3	Kinesin-associated
6	PF16796 Microtub_bd	4.5e-14	64.1	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005541152.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005572437.1	0.803	Plays a role in cytokinesis. Displays serine/threonine protein kinase activity
2	9541.XP_005540011.1	0.739	Kinesin-associated protein 3 isoform X1
3	9541.XP_005560582.1	0.631	Protein regulator of cytokinesis 1 isoform X1
4	9541.XP_005566877.1	0.619	KIF1-binding protein
5	9541.XP_005571404.1	0.550	Kinesin heavy chain isoform 5A
6	9541.XP_005553157.1	0.545	Kinesin-like protein KIF6 isoform X1
7	9541.XP_005566011.1	0.544	Kinesin-like protein KIF11
8	9541.XP_005557943.1	0.538	Kinesin-like protein KIF20A
9	9541.XP_005570857.1	0.538	Male germ cell RacGap
10	9541.XP_005592922.1	0.536	Polycystin 1 like 2
11	9541.XP_005580215.1	0.532	Rho GTPase-activating protein 32 isoform X1
12	9541.XP_005575603.1	0.519	Uncharacterized protein
13	9541.XP_005564979.1	0.518	Kinesin-like protein
14	9541.XP_005557034.1	0.500	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003777	0.995	microtubule motor activity
GO:0008092	0.932	cytoskeletal protein binding
GO:0015631	0.510	tubulin binding
GO:0042802	0.372	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007017	0.992	microtubule-based process
GO:0051179	0.989	localization
GO:0016043	0.966	cellular component organization
GO:0051234	0.954	establishment of localization
GO:0006996	0.884	organelle organization
GO:0007018	0.881	microtubule-based movement
GO:0051649	0.860	establishment of localization in cell
GO:0030705	0.854	cytoskeleton-dependent intracellular transport
GO:0051656	0.603	establishment of organelle localization
GO:0099111	0.572	microtubule-based transport
GO:0022607	0.391	cellular component assembly
GO:0050789	0.338	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0043232	0.971	intracellular non-membrane-bounded organelle
GO:0005856	0.961	cytoskeleton
GO:0015630	0.945	microtubule cytoskeleton
GO:0043005	0.608	neuron projection
GO:0016020	0.446	membrane
GO:0005739	0.349	mitochondrion
GO:0099513	0.318	polymeric cytoskeletal fiber
GO:0005874	0.313	microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]