StarFunc result for job id C9J069

User Input

>input (976 residues)
MTRTDPPDLLVSTVYQDIKVATPGPASKCSPCERSVARPAEPAPFNKRHCRSFDFLEALD
GPAMETLPEPPPPESAVPRARTREAEPRRRARSKSAPRAPPGLTPAPASPPVLPRRGREA
QRAARAEASPRREPAYPALRALANELHPIKLQPQRGGPGRVAPLCAAAGRCAPPEPPAGP
APHVRCRLDIKPDDAVLQHATRGSRSCGPTEAAHWARPAPQFHGLTVPGPRHMALSRTPT
PSDSYCADPRAFYCDGPLPGPRDYAERRSLPFTTPPGPTQFFYTEEPQGFRGSFAASPGP
TFDAYYPRPYPSEELSGPSPRRMGGYYAGEVRTFPIQEPPSRSYYGEAPRAYGLPYGPRY
VPEEPRAHSTARPFYTEDFGRYRERDVLARTYPHPRSSPAWADWGPRPYRTLQVVPPSDP
DPLLASWHGGTGTSPPRLATDSRHYSRSWDNILAPGPRREDPLGRGRSYENLLGREVREP
RGVSPEGRRPPVVVNLSTSPRRYAALSLSETSLTEKGRAGEGLGRNWYVTPEITITDNDL
RATERPSARAWELPGGRTRPPPHAAPDGPTSGRQRSLEQLDELITDLVIDSRPTAGQASE
PAADCLGPQLRRLLDSRPAGSGAPALAPPRSPPASAGSAEEPAAPGEAADASPEPSADED
DLMTCSNARCRRTETMFNACLYFKSCHSCYTYYCSRLCRREDWDAHKARCVYGRVGSVCR
HVLQFCRDSGPVHRAFSRIARVGFLSRGRGVLFLGFPSPGSADNFLRFGLEGLLLSPTYL
SLRELATHAAPLGSYARELAAAGRLYEPAECFLLSVSVAVGPGTAPPGTPALPAPAPRSH
GPTVRKFAKVALAAGSPARPPPARSREPDMETLILTPPPGTAGLDQDGEAGRRAREVAFI
HIQRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEP
RALDWVASANLLDDIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M9PDE6	0.182	0.086	1.461E-20	2190	0.225	0.100	M9PDE6.pdb.gz	M9PDE6_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=CG6448 PE=1 SV=1
2	AFDB:Q96QE3	0.056	0.035	2.285E-2	1844	0.111	0.059	Q96QE3.pdb.gz	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
3	AFDB:Q90X47	0.053	0.031	1.122E-1	2101	0.071	0.033	Q90X47.pdb.gz
4	AFDB:Q6RJR6	0.041	0.042	1.420E-1	940	0.128	0.133	Q6RJR6.pdb.gz	RTN3_RAT Reticulon-3 OS=Rattus norvegicus OX=10116 GN=Rtn3 PE=1 SV=1
5	AFDB:P54253	0.047	0.054	2.022E-1	815	0.112	0.134	P54253.pdb.gz	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
6	AFDB:B7Z0K1	0.035	0.031	2.145E-1	1137	0.126	0.108	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
7	AFDB:Q57XU2	0.047	0.048	2.413E-1	912	0.109	0.116	Q57XU2.pdb.gz	Q57XU2_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.100 PE=4 SV=1
8	AFDB:Q4QY64	0.057	0.035	3.240E-1	1826	0.091	0.049	Q4QY64.pdb.gz	ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus OX=10090 GN=Atad5 PE=1 SV=1
9	AFDB:Q921U8	0.047	0.049	3.240E-1	923	0.099	0.105	Q921U8.pdb.gz	SMTN_MOUSE Smoothelin OS=Mus musculus OX=10090 GN=Smtn PE=1 SV=2
10	AFDB:Q9ULJ3	0.051	0.047	4.101E-1	1066	0.113	0.103	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
11	PDB:6h3cA	0.039	0.103	1.660	255	0.018	0.071	6h3cA.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
12	PDB:5apnP	0.040	0.158	1.868	183	0.010	0.055	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
13	PDB:6cxcB	0.032	0.075	2.229	358	0.012	0.034	6cxcB.pdb.gz
14	PDB:4zjaA	0.035	0.176	2.508	106	0.007	0.066	4zjaA.pdb.gz
15	PDB:4uhvB	0.033	0.046	3.571	645	0.025	0.037	4uhvB.pdb.gz
16	PDB:2outA	0.029	0.123	3.788	131	0.020	0.153	2outA.pdb.gz
17	PDB:2j0vB	0.033	0.140	4.018	184	0.008	0.043	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.
18	PDB:3j6bP	0.048	0.148	4.018	207	0.020	0.097	3j6bP.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
19	PDB:7pzyx	0.029	0.117	4.262	172	0.010	0.058	7pzyx.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
20	PDB:7qpdT	0.047	0.110	5.086	348	0.017	0.049	7qpdT.pdb.gz	Molecular basis of MHC I quality control in the peptide loading complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9V9N5	2.99e-36	149	778	0.115	0.144	Q9V9N5_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG42748 PE=1 SV=2
2	M9PDY6	4.75e-36	149	822	0.115	0.136	M9PDY6_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=CG6448 PE=1 SV=1
3	M9PDE6	8.03e-36	150	2190	0.115	0.051	M9PDE6_DROME Uncharacterized protein, isoform K OS=Drosophila melanogaster OX=7227 GN=CG6448 PE=1 SV=1
4	R9PY70	9.04e-36	150	2139	0.115	0.052	R9PY70_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG6448 PE=1 SV=1
5	A0A1C3NSL9	5.63e-23	108	1644	0.067	0.040	AJM1_CAEEL Apical junction molecule OS=Caenorhabditis elegans OX=6239 GN=ajm-1 PE=1 SV=1
6	A0A8I5ZUN3	0.085	39.7	35375	0.031	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
7	Q99MV1	0.18	38.1	1172	0.048	0.040	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
8	Q61831	0.31	37.0	464	0.052	0.110	MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus OX=10090 GN=Mapk10 PE=1 SV=2
9	Q9VHR5	0.47	36.6	642	0.011	0.017	Q9VHR5_DROME Tudor domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Veneno PE=1 SV=2
10	Q8MRT0	0.49	36.6	466	0.011	0.024	Q8MRT0_DROME SD27884p OS=Drosophila melanogaster OX=7227 GN=Veneno PE=2 SV=1
11	Q9BXT4	0.58	36.6	1180	0.014	0.012	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
12	Q24180	1.3	35.4	576	0.010	0.017	DEAF1_DROME Deformed epidermal autoregulatory factor 1 OS=Drosophila melanogaster OX=7227 GN=Deaf1 PE=1 SV=1
13	Q9VT55	1.6	35.0	1339	0.029	0.021	Q9VT55_DROME Uncharacterized protein, isoform N OS=Drosophila melanogaster OX=7227 GN=CG32049 PE=1 SV=3
14	M9PF57	1.7	35.0	1385	0.029	0.020	M9PF57_DROME Uncharacterized protein, isoform M OS=Drosophila melanogaster OX=7227 GN=CG8154 PE=1 SV=1
15	Q9FYF9	2.4	34.3	379	0.023	0.058	FB76_ARATH F-box protein At1g67340 OS=Arabidopsis thaliana OX=3702 GN=At1g67340 PE=1 SV=1
16	Q4VC12	2.7	34.3	460	0.020	0.043	MSS51_HUMAN Putative protein MSS51 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=MSS51 PE=1 SV=2
17	Q9N3Q8	4.3	33.5	388	0.012	0.031	DAF25_CAEEL Dauer abnormal formation protein 25 OS=Caenorhabditis elegans OX=6239 GN=daf-25 PE=2 SV=2
18	Q8WZ42	7.0	33.1	34350	0.031	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
19	P52179	8.6	32.7	1685	0.038	0.022	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03752 ALF	2.3e+02	13.1	Short repeats of unknown function

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412388

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344155	0.693	ATP-binding cassette sub-family A member 2
2	9606.ENSP00000256103	0.664	Myelin P2 protein
3	9606.ENSP00000275954	0.652	Transmembrane protein 47
4	9606.ENSP00000216027	0.608	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
5	9606.ENSP00000337040	0.520	Protein unc-119 homolog A
6	9606.ENSP00000027335	0.505	Cadherin-17
7	9606.ENSP00000243918	0.505	Protein SYS1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.998	enzyme binding
GO:0008157	0.897	protein phosphatase 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0065007	0.850	biological regulation
GO:0050789	0.810	regulation of biological process
GO:0050794	0.802	regulation of cellular process
GO:0071840	0.522	cellular component organization or biogenesis
GO:0016043	0.493	cellular component organization
GO:0008152	0.334	metabolic process
GO:0032501	0.313	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.996	organelle
GO:0005622	0.995	intracellular anatomical structure
GO:0005737	0.993	cytoplasm
GO:0043229	0.958	intracellular organelle
GO:0016020	0.934	membrane
GO:0043227	0.911	membrane-bounded organelle
GO:0043231	0.834	intracellular membrane-bounded organelle
GO:0005886	0.609	plasma membrane
GO:0012505	0.452	endomembrane system
GO:0005829	0.419	cytosol
GO:0030054	0.409	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]