StarFunc result for job id C9J2P7

User Input

>input (553 residues)
MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRH
KGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQL
VKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKIDKNVQYPEC
LDMKLYMSQTNSGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
DEHLVERATQESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHP
EQQSSLLNLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQWSQWKYRPTR
RGAHTHAHTQTHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0WX57	0.767	0.799	3.199E-95	530	0.946	0.987	Q0WX57.pdb.gz	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	AFDB:E9Q9U0	0.545	0.641	2.349E-48	468	0.380	0.449	E9Q9U0.pdb.gz	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
3	AFDB:Q385P1	0.528	0.388	6.179E-31	765	0.241	0.174	Q385P1.pdb.gz	Q385P1_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2940 PE=3 SV=1
4	PDB:3mhsA	0.481	0.580	1.458E-27	455	0.177	0.215	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
5	AFDB:F1M625	0.483	0.715	4.131E-26	366	0.161	0.243	F1M625.pdb.gz	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
6	AFDB:Q96V54	0.455	0.335	4.373E-26	766	0.221	0.159	Q96V54.pdb.gz	CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=creB PE=1 SV=1
7	AFDB:E7EY58	0.457	0.238	1.152E-25	1092	0.165	0.083	E7EY58.pdb.gz
8	AFDB:P34547	0.479	0.615	3.811E-25	426	0.163	0.211	P34547.pdb.gz	UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans OX=6239 GN=usp-46 PE=1 SV=3
9	AFDB:O75317	0.481	0.703	5.068E-25	370	0.161	0.241	O75317.pdb.gz	UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens OX=9606 GN=USP12 PE=1 SV=2
10	PDB:4fjcE	0.429	0.540	7.261E-25	434	0.165	0.210	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
11	AFDB:Q9UPU5	0.462	0.104	7.551E-25	2620	0.172	0.036	Q9UPU5.pdb.gz	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
12	PDB:5cvnB	0.476	0.796	1.213E-24	321	0.156	0.268	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	AFDB:Q76LT8	0.452	0.248	1.335E-24	1036	0.172	0.092	Q76LT8.pdb.gz	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
14	PDB:8a9kD	0.428	0.803	7.092E-24	285	0.130	0.253	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
15	PDB:4wa6D	0.432	0.570	4.148E-23	415	0.161	0.214	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:5k16B	0.452	0.726	9.750E-23	328	0.150	0.253	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
17	PDB:7ay1D	0.462	0.727	1.093E-22	341	0.141	0.229	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:7yxxA	0.452	0.152	2.045E-22	1754	0.174	0.055	7yxxA.pdb.gz
19	PDB:5gjqx	0.456	0.687	1.644E-20	355	0.137	0.214	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:7w3ax	0.440	0.488	1.741E-20	494	0.139	0.156	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0WX57	0.0	1097	530	0.946	0.987	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	Q6QN14	0.0	824	398	0.707	0.982	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
3	Q6R6M4	0.0	1042	530	0.906	0.945	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
4	G5E8I7	1.86e-146	434	545	0.450	0.457	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
5	G5E8G2	1.55e-144	429	545	0.430	0.437	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
6	Q61068	1.60e-144	429	526	0.441	0.464	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
7	E9Q9U0	1.13e-143	424	468	0.392	0.464	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
8	Q7M764	6.47e-142	422	540	0.432	0.443	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
9	Q9H9J4	2.71e-141	442	1324	0.380	0.159	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
10	B2RQC2	8.68e-140	439	1324	0.378	0.158	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
11	E9PEW0	4.75e-128	387	548	0.324	0.327	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
12	E7F4C0	2.28e-122	388	1104	0.333	0.167	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
13	Q9P275	2.60e-122	388	1123	0.322	0.159	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
14	B1AQJ2	2.03e-120	382	1098	0.322	0.162	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
15	O74442	1.09e-79	259	457	0.259	0.313	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
16	Q9FPS9	1.10e-69	243	924	0.219	0.131	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
17	F4I642	1.16e-69	243	928	0.219	0.130	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
18	Q9SB51	2.82e-58	211	1008	0.199	0.109	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
19	Q9VRP5	6.57e-53	196	1038	0.212	0.113	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
20	Q9FIQ1	6.97e-49	182	732	0.197	0.149	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04774 HABP4_PAI-RBP1	0.59	22.3	Hyaluronan / mRNA binding family
2	PF00443 UCH	4.3e-48	175.8	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	2.3e-11	55.5	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333329	0.900	Ubiquitin carboxyl-terminal hydrolase 17
2	9606.ENSP00000389443	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 12
3	9606.ENSP00000400880	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 11
4	9606.ENSP00000403760	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 10
5	9606.ENSP00000414392	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 13
6	9606.ENSP00000422216	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 21
7	9606.ENSP00000422621	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 17
8	9606.ENSP00000423115	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 22
9	9606.ENSP00000423503	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 18
10	9606.ENSP00000425582	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 19
11	9606.ENSP00000425955	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 5
12	9606.ENSP00000427264	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 20
13	9606.ENSP00000485243	0.900	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4
14	9606.ENSP00000485306	0.900	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8
15	9606.ENSP00000485323	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 3
16	9606.ENSP00000485364	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 1
17	9606.ENSP00000309163	0.637	CAAX prenyl protease 2
18	9606.ENSP00000443988	0.606	Sin3 histone deacetylase corepressor complex component SDS3
19	9606.ENSP00000263642	0.600	Interferon-induced helicase C domain-containing protein 1
20	9606.ENSP00000303706	0.600	M-phase inducer phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0097159	0.973	organic cyclic compound binding
GO:0005515	0.973	protein binding
GO:1901363	0.972	heterocyclic compound binding
GO:0003676	0.958	nucleic acid binding
GO:0003723	0.949	RNA binding
GO:0097367	0.686	carbohydrate derivative binding
GO:0005540	0.570	hyaluronic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0050789	0.976	regulation of biological process
GO:0019538	0.975	protein metabolic process
GO:0016579	0.965	protein deubiquitination
GO:0050794	0.926	regulation of cellular process
GO:0009987	0.925	cellular process
GO:0048518	0.798	positive regulation of biological process
GO:0050896	0.568	response to stimulus
GO:0048522	0.565	positive regulation of cellular process
GO:0019222	0.557	regulation of metabolic process
GO:0060255	0.536	regulation of macromolecule metabolic process
GO:0051716	0.475	cellular response to stimulus
GO:0080090	0.462	regulation of primary metabolic process
GO:0051171	0.454	regulation of nitrogen compound metabolic process
GO:0042981	0.447	regulation of apoptotic process
GO:0010468	0.358	regulation of gene expression
GO:0048583	0.356	regulation of response to stimulus
GO:0080134	0.347	regulation of response to stress
GO:0007165	0.335	signal transduction
GO:0051246	0.308	regulation of protein metabolic process
GO:0065009	0.307	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.992	nuclear lumen
GO:0005829	0.976	cytosol
GO:0043232	0.947	intracellular non-membrane-bounded organelle
GO:0016020	0.884	membrane
GO:0012505	0.711	endomembrane system
GO:0005789	0.585	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]