StarFunc result for job id C9JG80

User Input

>input (1138 residues)
MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPW
LHVIIAFPTSYKVVITLWIVYLWVSLLKTIFWSRNGHDGSTDVQQRAWRSNRRRQEGLRS
ICMHTKKRVSSFRGNKIVLKDVITLRRHVETKVRAKIRKRKVTTKINHHDKINGKRKTAR
KQKMFQRAQELRRRAEDYHKCKIPPSARKALCNWVRMAAAEHRHSSGLPYWPYLTAETLK
NRMGHQPPPPTQQHSITDNSLSLKTPPECLLTPLPPSADDNLKTPPECVLTPLPPSADDN
LKTPPECVLTPLPPSADDNLKTPPECLLTPLPPSADDKLKTPPECLLTPLPPSALPSAPP
SADDNLKTRAECLLHPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLP
PSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPL
PPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAER
LRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSE
RQLTPLPPSAPPSADDNIKTPAFHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRYLLSV
CGFRFHHQPMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLPS
VSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLPSVSSLPFHPQLHPQQMIIS
RHLPSVCGGRFHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMII
SRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGERLRGPLPPSADDNLKTPSERQLTPLPP
SAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLR
GPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPPLAT
QEAEAEKPRKPKRQRAAEMEPPPEPKRRRVGDVEPSRKPKRRRAADVEPSSPEPKRRRVG
DVEPSRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKPKRRRAADVEPSLPEPKRRRLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C9JG80	1.000	1.000	0.000	1138	1.000	1.000	C9JG80.pdb.gz	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
2	AFDB:E5RHQ5	0.220	0.216	0.000	1161	0.917	0.899	E5RHQ5.pdb.gz	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
3	AFDB:Q92617	0.274	0.293	0.000	1050	0.918	0.995	Q92617.pdb.gz	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
4	AFDB:A6NJU9	0.223	0.223	1.135E-90	1138	0.893	0.893	A6NJU9.pdb.gz	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
5	AFDB:A1Z8P9	0.041	0.026	6.661E-4	2346	0.104	0.050	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
6	AFDB:Q54G14	0.047	0.048	2.669E-3	1081	0.078	0.082	Q54G14.pdb.gz	Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290685 PE=2 SV=2
7	AFDB:Q9C105	0.062	0.059	3.826E-3	1236	0.095	0.087	Q9C105.pdb.gz	YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1E7.04c PE=3 SV=1
8	AFDB:P47179	0.067	0.066	4.028E-3	1161	0.071	0.070	P47179.pdb.gz	DAN4_YEAST Cell wall protein DAN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAN4 PE=2 SV=1
9	AFDB:Q2IBD4	0.042	0.031	7.464E-3	1649	0.095	0.065	Q2IBD4.pdb.gz	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
10	AFDB:Q9HDY9	0.065	0.067	1.314E-2	1082	0.069	0.073	Q9HDY9.pdb.gz	MAM3_SCHPO M cell-type agglutination protein mam3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mam3 PE=3 SV=2
11	PDB:2oi6B	0.064	0.112	1.545E-1	452	0.018	0.046	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.
12	PDB:3d8vA	0.064	0.111	9.343E-1	478	0.013	0.031	3d8vA.pdb.gz	Structure and function of GlmU from Mycobacterium tuberculosis.
13	PDB:3foqA	0.064	0.108	9.343E-1	439	0.014	0.036	3foqA.pdb.gz	Structure of N-acetylglucosamine-1-phosphate uridyltransferase (GlmU) from Mycobacterium tuberculosis in a cubic space group.
14	PDB:3tioF	0.035	0.080	1.919	177	0.018	0.113	3tioF.pdb.gz	Structures of the gamma-class carbonic anhydrase homologue YrdA suggest a possible allosteric switch
15	PDB:3tv0A	0.041	0.160	2.239	143	0.018	0.140	3tv0A.pdb.gz
16	PDB:7aqqy	0.038	0.102	3.048	268	0.009	0.037	7aqqy.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
17	PDB:7ojpZ	0.053	0.100	5.649	261	0.015	0.065	7ojpZ.pdb.gz	Discovery of Novel UDP- N -Acetylglucosamine Acyltransferase (LpxA) Inhibitors with Activity against Pseudomonas aeruginosa .
18	PDB:2jf2A	0.063	0.147	5.947	264	0.013	0.057	2jf2A.pdb.gz
19	PDB:1thjA	0.047	0.121	6.261	213	0.011	0.056	1thjA.pdb.gz	A left-hand beta-helix revealed by the crystal structure of a carbonic anhydrase from the archaeon Methanosarcina thermophila.
20	PDB:5l6sN	0.030	0.058	7.305	369	0.016	0.049	5l6sN.pdb.gz	Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJU9	0.0	1316	1138	0.651	0.651	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
2	A8MRT5	0.0	1892	1133	0.954	0.959	NPIB5_HUMAN Nuclear pore complex-interacting protein family member B5 OS=Homo sapiens OX=9606 GN=NPIPB5 PE=2 SV=3
3	C9JG80	0.0	2239	1138	1.000	1.000	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
4	E5RHQ5	0.0	1730	1161	0.913	0.895	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
5	E9PKP1	0.0	1147	595	0.520	0.995	E9PKP1_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
6	F5H4N5	0.0	739	358	0.313	0.994	F5H4N5_HUMAN Nuclear pore complex interacting protein family member B3 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB3 PE=3 SV=1
7	F6SDX0	0.0	1147	595	0.520	0.995	F6SDX0_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
8	F8W0I5	0.0	1002	928	0.550	0.675	NPB12_HUMAN Nuclear pore complex-interacting protein family member B12 OS=Homo sapiens OX=9606 GN=NPIPB12 PE=3 SV=2
9	Q92617	0.0	1795	1050	0.915	0.991	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
10	E9PQR5	7.84e-172	514	432	0.251	0.662	NPIB8_HUMAN Nuclear pore complex-interacting protein family member B8 OS=Homo sapiens OX=9606 GN=NPIPB8 PE=3 SV=1
11	E9PJ23	1.33e-169	508	425	0.239	0.640	NPIB6_HUMAN Nuclear pore complex-interacting protein family member B6 OS=Homo sapiens OX=9606 GN=NPIPB6 PE=3 SV=1
12	E9PNV8	1.23e-160	483	369	0.232	0.715	E9PNV8_HUMAN Nuclear pore complex interacting protein family member A3 OS=Homo sapiens OX=9606 GN=NPIPA3 PE=3 SV=1
13	E9PIF3	6.07e-154	465	369	0.228	0.705	NPIA2_HUMAN Nuclear pore complex-interacting protein family member A2 OS=Homo sapiens OX=9606 GN=NPIPA2 PE=3 SV=1
14	A6NJ64	1.67e-149	455	397	0.216	0.620	NPIB2_HUMAN Putative nuclear pore complex-interacting protein family member B2 OS=Homo sapiens OX=9606 GN=NPIPB2 PE=5 SV=4
15	A0A0B4J1W7	2.27e-142	435	369	0.207	0.640	NPIA9_HUMAN Nuclear pore complex-interacting protein family member A9 OS=Homo sapiens OX=9606 GN=NPIPA9 PE=3 SV=1
16	A6NHN6	1.87e-141	436	443	0.214	0.549	NPB15_HUMAN Nuclear pore complex-interacting protein family member B15 OS=Homo sapiens OX=9606 GN=NPIPB15 PE=3 SV=3
17	F8W1W9	1.58e-139	430	429	0.216	0.573	NPIB9_HUMAN Nuclear pore complex-interacting protein family member B9 OS=Homo sapiens OX=9606 GN=NPIPB9 PE=3 SV=1
18	A0A1B0GW90	7.24e-139	426	370	0.198	0.608	A0A1B0GW90_HUMAN Uncharacterized protein (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
19	I3L0I5	4.08e-138	426	421	0.214	0.580	I3L0I5_HUMAN Nuclear pore complex interacting protein family member B7 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB7 PE=3 SV=2
20	E9PS57	5.97e-138	425	407	0.205	0.572	E9PS57_HUMAN Nuclear pore complex interacting protein family member B6 OS=Homo sapiens OX=9606 GN=NPIPB6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12178 INCENP_N	6.1	18.2	Chromosome passenger complex (CPC) protein INCENP N terminal
2	PF06409 NPIP	2e-159	540.4	Nuclear pore complex interacting protein (NPIP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404439

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396234	0.600	DEP domain containing 4
2	9606.ENSP00000479693	0.504	Neuroblastoma breakpoint family member 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.645	cellular process
GO:0065007	0.525	biological regulation
GO:0008152	0.451	metabolic process
GO:0044237	0.380	cellular metabolic process
GO:0050789	0.363	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.482	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]