StarFunc result for job id C9JH25

User Input

>input (899 residues)
MARHGCLGLGLFCCVLFAATVGPQPTPSIPGAPATTLTPVPQSEASMLSLNLGLNFKFHL
RGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGSTEGGS
KPRASSLLPESTSRRSGPSDGPTAPYQPRRSTVTWDTALMVTALPSSAPRPHQSELELKF
DMALRAGAAPTLGHRTLPLLPSLRASLAEIAGRLGPFGFFGTTLSPLRNFSGLSPPGETT
STSSASGVSGSLGFLGTTLSLPPYSLERKLSSPSPLDPAASLSFASIATTSLDPTVPISG
PDDLSPPASLGNPSGQPECGPGSCSVGELPEREGQPPEAPRPLFFLTLEADWAEARARWG
LAWEAHVYGVGALFGLVALLALLALALLPWRCPPGAPCLALLDLLLLSAGTTRAFPLFYD
AYGHRDRLPALAWLLLQDLPLPCLAAGLGLACLLLARPRPPRCPTGLAALLLLGLGLAAA
AALGSAAHRPLRPLRLASRGLHAFLAAFLSGLLLALSCWGGRRRRAGAPLGGSGFKGATP
LPQGRSPFAPRESWRRAARTAPVAGTFGLLSGALQGYEVLHALGYGGQSGLEGPWPWWAF
QLGLRLGEVGVALPLALLGLYPALCSPRVPPRCWAKLFRLSPGHAAPLLPGGWVTGPPDK
EPLGSAIARGDAELLQLCALAGPGPDLLLQGGGCRGFEGAAANPAPSPASSPCSDYTVDF
RPPSPINLRRSIEEALCSEALLAPGLFQGPAFEDALPGLGLYRTASLGTGGRASERSGEA
SGPAAPPELPSPGAWPAGSSVSSGSFCGLSRDSSSMLLCSSPDRPPRCPLVCVLSPPRPS
GSSPSLPASGSYQALSPPSRDSPEPASELQAEEALLQEQFLDACRQIDELSVGSDTIDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14029	0.065	0.038	5.990E-4	1995	0.145	0.065	O14029.pdb.gz	SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec16 PE=1 SV=2
2	PDB:7td1R	0.197	0.497	1.586E-3	293	0.038	0.116	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
3	PDB:7vktA	0.202	0.539	2.791E-3	287	0.047	0.146	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
4	PDB:8dwcR	0.192	0.556	2.791E-3	250	0.044	0.160	8dwcR.pdb.gz	Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.
5	PDB:7w53R	0.183	0.481	5.151E-3	264	0.047	0.159	7w53R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
6	PDB:7vv6R	0.187	0.501	6.219E-3	271	0.037	0.122	7vv6R.pdb.gz	Structure, function and pharmacology of human itch receptor complexes.
7	PDB:7y12R	0.210	0.599	6.834E-3	264	0.046	0.155	7y12R.pdb.gz	Structural insight into the activation mechanism of MrgD with heterotrimeric Gi-protein revealed by cryo-EM.
8	PDB:7vl9R	0.194	0.449	7.509E-3	302	0.050	0.149	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
9	AFDB:F1RBK4	0.065	0.056	7.631E-3	1216	0.167	0.123	F1RBK4.pdb.gz
10	PDB:7f1qR	0.219	0.463	9.067E-3	367	0.043	0.106	7f1qR.pdb.gz
11	PDB:6osaR	0.225	0.528	9.963E-3	321	0.046	0.128	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
12	AFDB:A0A0B4LFF3	0.068	0.065	1.012E-2	936	0.135	0.129	A0A0B4LFF3.pdb.gz	A0A0B4LFF3_DROME Stac-like, isoform P OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
13	AFDB:Q86SQ0	0.053	0.040	1.112E-2	1253	0.155	0.111	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
14	PDB:8ef5M	0.183	0.470	1.203E-2	288	0.042	0.132	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
15	AFDB:Q99569	0.067	0.059	1.222E-2	1192	0.155	0.117	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
16	AFDB:Q8K1N2	0.073	0.061	2.152E-2	1249	0.140	0.101	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
17	AFDB:A8DZ29	0.058	0.039	3.788E-2	1919	0.160	0.075	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
18	AFDB:E3W994	0.069	0.053	4.363E-2	1273	0.142	0.101	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
19	AFDB:G5E870	0.059	0.036	5.522E-2	2025	0.151	0.067	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
20	AFDB:Q28139	0.061	0.049	5.522E-2	1216	0.136	0.100	Q28139.pdb.gz	NCKX1_BOVIN Sodium/potassium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC24A1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z9I8	0.019	41.6	5385	0.057	0.009	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
2	B7YZG2	0.019	41.6	5370	0.057	0.009	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
3	A1Z9J0	0.021	41.2	5201	0.057	0.010	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
4	B7YZG3	0.021	41.2	5375	0.057	0.009	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
5	Q7KJN8	0.021	41.2	5201	0.057	0.010	Q7KJN8_DROME Short stop/Kakapo long isoform OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
6	A1Z9I9	0.022	41.2	5390	0.057	0.009	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	A1Z9J1	0.022	41.2	5501	0.057	0.009	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	A1Z9J2	0.022	41.2	5160	0.057	0.010	A1Z9J2_DROME Short stop, isoform C OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	B7YZG5	0.022	41.2	5486	0.057	0.009	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	E1JH64	0.022	41.2	5155	0.057	0.010	E1JH64_DROME Short stop, isoform Q OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	O96936	0.022	41.2	4151	0.057	0.012	O96936_DROME Kakapo (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
12	A1Z9J3	0.046	40.0	8805	0.057	0.006	A1Z9J3_DROME Short stop, isoform H OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	A0A0B4K867	0.068	39.7	5463	0.047	0.008	A0A0B4K867_DROME Short stop, isoform Y OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	A0A0B4K7P8	0.31	37.4	5394	0.055	0.009	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	B7YZG4	0.31	37.4	5368	0.055	0.009	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	A0A0B4K7Y9	0.34	37.4	5408	0.055	0.009	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	E1JH62	0.34	37.4	5388	0.055	0.009	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	A0A0B4K869	0.35	37.4	5434	0.055	0.009	A0A0B4K869_DROME Short stop, isoform AD OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	B7YZG6	0.36	37.4	5479	0.055	0.009	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	E1JH63	0.36	37.4	5499	0.055	0.009	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356124	0.615	Kelch domain containing 8A
2	9606.ENSP00000013070	0.546	Putative E3 ubiquitin-protein ligase UBR7
3	9606.ENSP00000380747	0.518	Transmembrane protein 209

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.633	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050794	0.951	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.991	membrane
GO:0005622	0.875	intracellular anatomical structure
GO:0005737	0.856	cytoplasm
GO:0043226	0.837	organelle
GO:0043229	0.812	intracellular organelle
GO:0071944	0.695	cell periphery
GO:0005886	0.547	plasma membrane
GO:0043227	0.419	membrane-bounded organelle
GO:0005576	0.418	extracellular region
GO:0005615	0.371	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]