StarFunc result for job id C9JJH3

User Input

>input (530 residues)
MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVAR
QLAPREKPPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYKPPLANYMLFREHSQTCHRH
KGCMLCTMQAHITRALHIPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMRKACLPGH
KQVDRHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQL
VKPEELNGENAYHCGVCLQRAPASKTLTLHNSAKVLILVLKRFPDVTGNKIAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYSSYVKAQEGQWYKMDDAEVTASSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGVEDTDRRATQGELKRDHPCLQAPEL
DEHLVERATQESTLDHWKFLQEQNKTKPEFNVRRVEGTVPPDVLVIHQSKYKCRMKNHHP
EQQSSLLNLSSTTPTDQESMNTGTLASLRGRTRRSKGKNKHSKRALLVCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0WX57	0.780	0.780	1.735E-93	530	0.966	0.966	Q0WX57.pdb.gz	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	AFDB:Q9H9J4	0.583	0.239	2.250E-52	1324	0.455	0.182	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
3	AFDB:B2RQC2	0.584	0.240	2.994E-51	1324	0.443	0.177	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
4	AFDB:B1AQJ2	0.568	0.281	9.977E-49	1098	0.389	0.188	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
5	AFDB:Q7M764	0.578	0.568	3.338E-48	540	0.425	0.417	Q7M764.pdb.gz	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
6	AFDB:E9Q9U0	0.545	0.616	1.253E-47	468	0.379	0.429	E9Q9U0.pdb.gz	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
7	AFDB:O74442	0.541	0.624	3.284E-40	457	0.266	0.309	O74442.pdb.gz	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
8	AFDB:Q385P1	0.521	0.368	4.057E-31	765	0.245	0.170	Q385P1.pdb.gz	Q385P1_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2940 PE=3 SV=1
9	AFDB:E9QFQ5	0.516	0.669	1.016E-29	404	0.185	0.243	E9QFQ5.pdb.gz	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
10	PDB:3mhsA	0.495	0.572	3.106E-29	455	0.181	0.211	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
11	AFDB:X2JLM6	0.508	0.478	4.040E-29	565	0.194	0.182	X2JLM6.pdb.gz	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
12	PDB:5cvnB	0.494	0.793	4.891E-26	321	0.157	0.259	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:4fjcE	0.451	0.544	1.094E-25	434	0.162	0.198	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:8a9kD	0.440	0.791	1.633E-24	285	0.136	0.253	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
15	PDB:7ay1D	0.494	0.744	9.713E-24	341	0.145	0.226	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
16	PDB:4wa6D	0.434	0.549	1.154E-23	415	0.160	0.205	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
17	PDB:5k16B	0.471	0.732	2.582E-23	328	0.164	0.265	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
18	PDB:7yxxA	0.482	0.154	1.220E-22	1754	0.183	0.055	7yxxA.pdb.gz
19	PDB:5gjqx	0.461	0.670	2.885E-21	355	0.149	0.223	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:7w3ax	0.462	0.493	6.093E-21	494	0.149	0.160	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0WX57	0.0	1071	530	0.966	0.966	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	Q6QN14	0.0	813	398	0.730	0.972	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
3	Q6R6M4	0.0	1033	530	0.936	0.936	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
4	G5E8I7	8.29e-143	424	545	0.460	0.448	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
5	G5E8G2	3.71e-141	420	545	0.440	0.428	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
6	Q61068	2.63e-139	414	526	0.449	0.452	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
7	E9Q9U0	1.37e-138	410	468	0.400	0.453	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
8	Q9H9J4	3.85e-138	433	1324	0.394	0.158	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
9	B2RQC2	6.56e-137	430	1324	0.392	0.157	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
10	Q7M764	1.62e-136	408	540	0.440	0.431	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
11	E9PEW0	4.84e-125	379	548	0.334	0.323	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
12	E7F4C0	5.83e-119	378	1104	0.343	0.165	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
13	Q9P275	8.62e-119	378	1123	0.332	0.157	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
14	B1AQJ2	1.15e-116	372	1098	0.325	0.157	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
15	O74442	3.99e-75	246	457	0.262	0.304	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
16	F4I642	5.43e-68	238	928	0.226	0.129	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
17	Q9FPS9	7.33e-68	237	924	0.226	0.130	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
18	Q9SB51	5.12e-58	210	1008	0.208	0.109	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
19	Q9VRP5	1.62e-50	188	1038	0.215	0.110	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
20	Q9FIQ1	5.94e-49	182	732	0.206	0.149	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04774 HABP4_PAI-RBP1	2.1	20.4	Hyaluronan / mRNA binding family
2	PF18223 PilJ_C	3.8e+02	12.9	Pili PilJ C-terminal domain
3	PF00443 UCH	1e-45	168.0	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	3.8e-10	51.5	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403760

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000425955	0.918	Ubiquitin carboxyl-terminal hydrolase 17-like protein 5
2	9606.ENSP00000422216	0.911	Ubiquitin carboxyl-terminal hydrolase 17-like protein 21
3	9606.ENSP00000389443	0.910	Ubiquitin carboxyl-terminal hydrolase 17-like protein 12
4	9606.ENSP00000414392	0.904	Ubiquitin carboxyl-terminal hydrolase 17-like protein 13
5	9606.ENSP00000422621	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 17
6	9606.ENSP00000423115	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 22
7	9606.ENSP00000425582	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 19
8	9606.ENSP00000427264	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 20
9	9606.ENSP00000485306	0.903	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8
10	9606.ENSP00000423503	0.902	Ubiquitin carboxyl-terminal hydrolase 17-like protein 18
11	9606.ENSP00000485243	0.901	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4
12	9606.ENSP00000333329	0.900	Ubiquitin carboxyl-terminal hydrolase 17
13	9606.ENSP00000400880	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 11
14	9606.ENSP00000478980	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 15
15	9606.ENSP00000485323	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 3
16	9606.ENSP00000485364	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 1
17	9606.ENSP00000309163	0.637	CAAX prenyl protease 2
18	9606.ENSP00000443988	0.606	Sin3 histone deacetylase corepressor complex component SDS3
19	9606.ENSP00000263642	0.600	Interferon-induced helicase C domain-containing protein 1
20	9606.ENSP00000303706	0.600	M-phase inducer phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.976	protein binding
GO:0003676	0.907	nucleic acid binding
GO:0003723	0.892	RNA binding
GO:0097367	0.342	carbohydrate derivative binding
GO:0005540	0.314	hyaluronic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036211	0.996	protein modification process
GO:0016579	0.991	protein deubiquitination
GO:0050789	0.987	regulation of biological process
GO:0009987	0.984	cellular process
GO:0050794	0.956	regulation of cellular process
GO:0048518	0.867	positive regulation of biological process
GO:0019222	0.772	regulation of metabolic process
GO:0060255	0.644	regulation of macromolecule metabolic process
GO:0048522	0.612	positive regulation of cellular process
GO:0080090	0.588	regulation of primary metabolic process
GO:0051171	0.587	regulation of nitrogen compound metabolic process
GO:0050896	0.534	response to stimulus
GO:0010468	0.486	regulation of gene expression
GO:0051716	0.482	cellular response to stimulus
GO:0010941	0.451	regulation of cell death
GO:0042981	0.436	regulation of apoptotic process
GO:0051246	0.382	regulation of protein metabolic process
GO:0048519	0.368	negative regulation of biological process
GO:0007154	0.336	cell communication
GO:0007165	0.330	signal transduction
GO:0080134	0.318	regulation of response to stress
GO:0065009	0.304	regulation of molecular function
GO:0048584	0.304	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005737	0.984	cytoplasm
GO:0005829	0.974	cytosol
GO:0016020	0.973	membrane
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0012505	0.922	endomembrane system
GO:0031090	0.816	organelle membrane
GO:0042175	0.754	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.745	endoplasmic reticulum subcompartment
GO:0005789	0.725	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]