StarFunc result for job id C9JPN9

User Input

>input (530 residues)
MEEDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVAR
QLAPREKLPLSNRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRH
KGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQL
VKPEELNGENAYHCGVCLQRAPASKMLTLLTSAKVLILVLKRFSDVTGNKIAKNVQYPEC
LDMQPYMSQPNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCLQAPEL
DEHLVERATQESTLDHWKFLQEQNKTKPEFNVRKVEGTLPPDVLVIHQSKYKCGMKNHHP
EQQSSLLKLSSTTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0WX57	0.784	0.784	4.487E-98	530	0.987	0.987	Q0WX57.pdb.gz	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	AFDB:Q9H9J4	0.578	0.236	1.367E-54	1324	0.460	0.184	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
3	AFDB:Q7M764	0.590	0.580	9.974E-51	540	0.432	0.424	Q7M764.pdb.gz	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
4	AFDB:E9Q9U0	0.575	0.649	3.215E-50	468	0.396	0.449	E9Q9U0.pdb.gz	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
5	AFDB:A0A024R8V6	0.584	0.280	1.036E-49	1123	0.377	0.178	A0A024R8V6.pdb.gz
6	AFDB:Q385P1	0.551	0.388	6.521E-33	765	0.251	0.174	Q385P1.pdb.gz	Q385P1_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2940 PE=3 SV=1
7	AFDB:X2JLM6	0.517	0.486	1.213E-28	565	0.198	0.186	X2JLM6.pdb.gz	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
8	PDB:3mhsA	0.502	0.580	1.790E-28	455	0.177	0.207	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
9	AFDB:P53874	0.505	0.348	1.121E-27	792	0.192	0.129	P53874.pdb.gz	UBP10_YEAST Ubiquitin carboxyl-terminal hydrolase 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP10 PE=1 SV=2
10	AFDB:F1M625	0.507	0.723	1.791E-27	366	0.158	0.230	F1M625.pdb.gz	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
11	AFDB:Q96V54	0.484	0.342	3.614E-27	766	0.242	0.167	Q96V54.pdb.gz	CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=creB PE=1 SV=1
12	PDB:5cvnB	0.503	0.811	3.271E-26	321	0.158	0.262	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:4fjcE	0.453	0.546	1.332E-25	434	0.170	0.207	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:8a9kD	0.449	0.810	5.119E-25	285	0.138	0.256	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
15	PDB:5k16B	0.472	0.734	3.969E-24	328	0.168	0.271	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
16	PDB:7yxxA	0.480	0.154	1.617E-23	1754	0.179	0.054	7yxxA.pdb.gz
17	PDB:7ay1D	0.489	0.743	1.714E-23	341	0.149	0.232	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:4wa6D	0.450	0.570	2.435E-23	415	0.160	0.205	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
19	PDB:7w3ax	0.464	0.495	1.228E-21	494	0.149	0.160	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
20	PDB:5gjqx	0.477	0.692	3.133E-21	355	0.143	0.214	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0WX57	0.0	1097	530	0.987	0.987	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	Q6QN14	0.0	824	398	0.738	0.982	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
3	Q6R6M4	0.0	1041	530	0.943	0.943	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
4	G5E8I7	3.71e-145	430	545	0.466	0.453	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
5	E9Q9U0	1.06e-143	424	468	0.408	0.462	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
6	G5E8G2	2.99e-143	425	545	0.445	0.433	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
7	Q61068	3.06e-143	424	526	0.457	0.460	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
8	Q9H9J4	8.76e-143	446	1324	0.400	0.160	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
9	B2RQC2	2.31e-141	442	1324	0.398	0.159	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
10	Q7M764	1.23e-140	418	540	0.447	0.439	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
11	E9PEW0	2.50e-127	384	548	0.338	0.327	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
12	E7F4C0	1.09e-121	385	1104	0.347	0.167	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
13	Q9P275	2.07e-121	385	1123	0.336	0.159	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
14	B1AQJ2	2.17e-119	379	1098	0.328	0.158	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
15	O74442	1.22e-82	266	457	0.274	0.317	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
16	Q9FPS9	4.23e-68	238	924	0.226	0.130	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
17	F4I642	4.36e-68	238	928	0.226	0.129	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
18	Q9SB51	2.73e-59	214	1008	0.209	0.110	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
19	Q9VRP5	2.77e-52	194	1038	0.219	0.112	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
20	Q9FIQ1	2.92e-50	186	732	0.208	0.150	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04774 HABP4_PAI-RBP1	0.57	22.3	Hyaluronan / mRNA binding family
2	PF00443 UCH	3.3e-48	176.2	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	5.8e-11	54.2	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389443

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000422216	0.930	Ubiquitin carboxyl-terminal hydrolase 17-like protein 21
2	9606.ENSP00000425582	0.930	Ubiquitin carboxyl-terminal hydrolase 17-like protein 19
3	9606.ENSP00000425955	0.930	Ubiquitin carboxyl-terminal hydrolase 17-like protein 5
4	9606.ENSP00000403760	0.910	Ubiquitin carboxyl-terminal hydrolase 17-like protein 10
5	9606.ENSP00000414392	0.906	Ubiquitin carboxyl-terminal hydrolase 17-like protein 13
6	9606.ENSP00000423503	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 18
7	9606.ENSP00000427264	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 20
8	9606.ENSP00000485306	0.903	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8
9	9606.ENSP00000485323	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 3
10	9606.ENSP00000422621	0.902	Ubiquitin carboxyl-terminal hydrolase 17-like protein 17
11	9606.ENSP00000423115	0.902	Ubiquitin carboxyl-terminal hydrolase 17-like protein 22
12	9606.ENSP00000333329	0.900	Ubiquitin carboxyl-terminal hydrolase 17
13	9606.ENSP00000400880	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 11
14	9606.ENSP00000478980	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 15
15	9606.ENSP00000485243	0.900	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4
16	9606.ENSP00000485364	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 1
17	9606.ENSP00000309163	0.637	CAAX prenyl protease 2
18	9606.ENSP00000443988	0.606	Sin3 histone deacetylase corepressor complex component SDS3
19	9606.ENSP00000263642	0.600	Interferon-induced helicase C domain-containing protein 1
20	9606.ENSP00000303706	0.600	M-phase inducer phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.977	protein binding
GO:1901363	0.947	heterocyclic compound binding
GO:0097159	0.946	organic cyclic compound binding
GO:0003676	0.917	nucleic acid binding
GO:0003723	0.905	RNA binding
GO:0097367	0.432	carbohydrate derivative binding
GO:0005540	0.338	hyaluronic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036211	0.996	protein modification process
GO:0016579	0.991	protein deubiquitination
GO:0009987	0.985	cellular process
GO:0050789	0.984	regulation of biological process
GO:0050794	0.959	regulation of cellular process
GO:0048518	0.870	positive regulation of biological process
GO:0019222	0.804	regulation of metabolic process
GO:0060255	0.751	regulation of macromolecule metabolic process
GO:0048522	0.687	positive regulation of cellular process
GO:0080090	0.588	regulation of primary metabolic process
GO:0051171	0.588	regulation of nitrogen compound metabolic process
GO:0010468	0.518	regulation of gene expression
GO:0050896	0.496	response to stimulus
GO:0051716	0.476	cellular response to stimulus
GO:0010941	0.471	regulation of cell death
GO:0043067	0.455	regulation of programmed cell death
GO:0007154	0.447	cell communication
GO:0042981	0.441	regulation of apoptotic process
GO:0048519	0.387	negative regulation of biological process
GO:0051246	0.382	regulation of protein metabolic process
GO:0007165	0.377	signal transduction
GO:0048583	0.365	regulation of response to stimulus
GO:0080134	0.322	regulation of response to stress
GO:0065009	0.319	regulation of molecular function
GO:0048584	0.315	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0005737	0.982	cytoplasm
GO:0005829	0.972	cytosol
GO:0043232	0.960	intracellular non-membrane-bounded organelle
GO:0016020	0.939	membrane
GO:0012505	0.809	endomembrane system
GO:0005789	0.665	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]