StarFunc result for job id C9JQL5

User Input

>input (133 residues)
MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHHVVW
SLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGNVTGAQAYASTTKCLNIWALILGILMTIL
LIIIPVLIFQAHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01628	0.506	0.506	6.249E-16	133	0.932	0.932	Q01628.pdb.gz	IFM3_HUMAN Interferon-induced transmembrane protein 3 OS=Homo sapiens OX=9606 GN=IFITM3 PE=1 SV=2
2	AFDB:Q9CQW9	0.475	0.468	4.436E-11	137	0.662	0.642	Q9CQW9.pdb.gz	IFM3_MOUSE Interferon-induced transmembrane protein 3 OS=Mus musculus OX=10090 GN=Ifitm3 PE=1 SV=1
3	AFDB:Q99J93	0.559	0.525	3.886E-10	144	0.624	0.576	Q99J93.pdb.gz	IFM2_MOUSE Interferon-induced transmembrane protein 2 OS=Mus musculus OX=10090 GN=Ifitm2 PE=1 SV=1
4	AFDB:Q8C581	0.297	0.243	6.616E-1	172	0.188	0.145	Q8C581.pdb.gz	TMM91_MOUSE Transmembrane protein 91 OS=Mus musculus OX=10090 GN=Tmem91 PE=2 SV=1
5	AFDB:Q8IC43	0.138	0.155	9.703E-1	123	0.158	0.171	Q8IC43.pdb.gz	Q8IC43_PLAF7 Small exported membrane protein 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0702400 PE=4 SV=1
6	AFDB:O76064	0.329	0.128	1.102	485	0.135	0.037	O76064.pdb.gz	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
7	AFDB:Q4WYQ4	0.208	0.074	1.102	493	0.203	0.055	Q4WYQ4.pdb.gz	Q4WYQ4_ASPFU GATA-type sexual development transcription factor NsdD OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G13870 PE=4 SV=1
8	AFDB:Q4FZ76	0.185	0.082	1.423	321	0.143	0.059	Q4FZ76.pdb.gz	RTN2_XENLA Reticulon-2 OS=Xenopus laevis OX=8355 GN=rtn2 PE=2 SV=1
9	AFDB:Q18624	0.204	0.082	1.517	376	0.165	0.059	Q18624.pdb.gz	Q18624_CAEEL SAND domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gmeb-3 PE=1 SV=2
10	AFDB:E7F6S5	0.324	0.258	1.723	177	0.180	0.136	E7F6S5.pdb.gz
11	PDB:4ytpD	0.247	0.307	2.323	102	0.068	0.088	4ytpD.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
12	PDB:4ke2A	0.488	0.341	4.125	196	0.075	0.051	4ke2A.pdb.gz
13	PDB:7c4jH	0.308	0.194	4.397	242	0.150	0.083	7c4jH.pdb.gz
14	PDB:3j79T	0.196	0.149	5.325	181	0.105	0.077	3j79T.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
15	PDB:7qe7N	0.197	0.056	5.676	682	0.113	0.022	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:3favC	0.341	0.447	6.449	90	0.098	0.144	3favC.pdb.gz	WXG100 protein superfamily consists of three subfamilies and exhibits an alpha-helical C-terminal conserved residue pattern.
17	PDB:1ek8A	0.204	0.178	6.874	185	0.068	0.049	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.
18	PDB:6eznE	0.221	0.318	7.327	85	0.105	0.165	6eznE.pdb.gz	Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
19	PDB:6iczJ	0.162	0.064	7.810	571	0.068	0.016	6iczJ.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:7cpuLb	0.137	0.165	7.810	99	0.083	0.111	7cpuLb.pdb.gz	A male germ-cell-specific ribosome controls male fertility.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01628	5.47e-91	261	133	0.932	0.932	IFM3_HUMAN Interferon-induced transmembrane protein 3 OS=Homo sapiens OX=9606 GN=IFITM3 PE=1 SV=2
2	Q6IBB0	2.75e-84	244	132	0.880	0.886	Q6IBB0_HUMAN IFITM2 protein OS=Homo sapiens OX=9606 GN=IFITM2 PE=1 SV=1
3	Q01629	3.70e-84	244	132	0.887	0.894	IFM2_HUMAN Interferon-induced transmembrane protein 2 OS=Homo sapiens OX=9606 GN=IFITM2 PE=1 SV=2
4	E9PQN9	2.55e-70	208	112	0.744	0.884	E9PQN9_HUMAN Interferon induced transmembrane protein 2 OS=Homo sapiens OX=9606 GN=IFITM2 PE=1 SV=1
5	Q9CQW9	5.38e-57	175	137	0.609	0.591	IFM3_MOUSE Interferon-induced transmembrane protein 3 OS=Mus musculus OX=10090 GN=Ifitm3 PE=1 SV=1
6	P13164	3.09e-53	165	125	0.624	0.664	IFM1_HUMAN Interferon-induced transmembrane protein 1 OS=Homo sapiens OX=9606 GN=IFITM1 PE=1 SV=3
7	Q9R175	4.68e-53	166	144	0.617	0.569	Q9R175_RAT Interferon induced transmembrane protein 2 OS=Rattus norvegicus OX=10116 GN=Ifitm2 PE=1 SV=1
8	Q99J93	5.26e-50	158	144	0.571	0.528	IFM2_MOUSE Interferon-induced transmembrane protein 2 OS=Mus musculus OX=10090 GN=Ifitm2 PE=1 SV=1
9	F1M3Q1	1.22e-41	136	129	0.511	0.527	F1M3Q1_RAT Interferon induced transmembrane protein 1 OS=Rattus norvegicus OX=10116 GN=Ifitm1 PE=3 SV=3
10	Q9D103	1.08e-40	133	106	0.481	0.604	IFM1_MOUSE Interferon-induced transmembrane protein 1 OS=Mus musculus OX=10090 GN=Ifitm1 PE=2 SV=1
11	A6NNB3	2.20e-18	77.4	132	0.271	0.273	IFM5_HUMAN Interferon-induced transmembrane protein 5 OS=Homo sapiens OX=9606 GN=IFITM5 PE=1 SV=1
12	O88728	2.85e-17	74.3	134	0.218	0.216	IFM5_MOUSE Interferon-induced transmembrane protein 5 OS=Mus musculus OX=10090 GN=Ifitm5 PE=1 SV=1
13	G3V7W9	1.61e-16	72.4	134	0.211	0.209	G3V7W9_RAT Interferon induced transmembrane protein 5 OS=Rattus norvegicus OX=10116 GN=Ifitm5 PE=3 SV=1
14	D3ZFB6	3.63e-05	43.9	344	0.158	0.061	PRRT2_RAT Proline-rich transmembrane protein 2 OS=Rattus norvegicus OX=10116 GN=Prrt2 PE=1 SV=1
15	Q7Z6L0	4.35e-05	43.9	340	0.158	0.062	PRRT2_HUMAN Proline-rich transmembrane protein 2 OS=Homo sapiens OX=9606 GN=PRRT2 PE=1 SV=1
16	E9PUL5	4.37e-05	43.9	346	0.158	0.061	PRRT2_MOUSE Proline-rich transmembrane protein 2 OS=Mus musculus OX=10090 GN=Prrt2 PE=1 SV=1
17	O22920	0.21	33.1	831	0.203	0.032	CHX13_ARATH Cation/H(+) symporter 13 OS=Arabidopsis thaliana OX=3702 GN=CHX13 PE=1 SV=1
18	P52488	7.9	28.5	636	0.158	0.033	UBA2_YEAST Ubiquitin-activating enzyme E1-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA2 PE=1 SV=1
19	P20722	9.7	28.5	510	0.128	0.033	BMP6_MOUSE Bone morphogenetic protein 6 OS=Mus musculus OX=10090 GN=Bmp6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04505 CD225	4e-27	105.5	Interferon-induced transmembrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003813780.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806057.1	0.859	Interferon-induced transmembrane protein 2
2	9597.XP_003806031.1	0.732	ISG15 ubiquitin-like modifier
3	9597.XP_003806061.1	0.710	Interferon-induced transmembrane protein 1
4	9597.XP_003812098.1	0.708	Radical S-adenosyl methionine domain containing 2
5	9597.XP_003823949.1	0.700	MX dynamin like GTPase 1
6	9597.XP_003825392.1	0.699	Interferon-induced protein with tetratricopeptide repeats 1 isoform X1
7	9597.XP_008951645.1	0.687	Interferon alpha inducible protein 6
8	9597.XP_003825388.1	0.677	Interferon induced protein with tetratricopeptide repeats 3
9	9597.XP_003832494.1	0.676	2'-5'-oligoadenylate synthetase 1
10	9597.NP_001266147.1	0.675	Bone marrow stromal cell antigen 2
11	9597.XP_003825387.1	0.669	Interferon induced protein with tetratricopeptide repeats 2
12	9597.XP_003820461.1	0.667	Interferon stimulated exonuclease gene 20
13	9597.XP_003813973.1	0.662	Interferon-induced 35 kDa protein isoform X1
14	9597.XP_003832859.1	0.661	Interferon alpha-inducible protein 27, mitochondrial isoform X1
15	9597.XP_008959818.1	0.660	Vesicle-associated membrane protein-associated protein A
16	9597.XP_003823954.1	0.654	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family
17	9597.XP_008967335.1	0.647	CD81 molecule
18	9597.XP_008968532.1	0.642	Adenosine deaminase, RNA specific
19	9597.XP_008959476.1	0.641	Interferon regulatory factor 9 isoform X1
20	9597.XP_008976837.1	0.636	Signal transducer and activator of transcription 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009605	0.995	response to external stimulus
GO:0006950	0.995	response to stress
GO:0098542	0.994	defense response to other organism
GO:0009615	0.984	response to virus
GO:1903901	0.965	negative regulation of viral life cycle
GO:0043903	0.964	regulation of biological process involved in symbiotic interaction
GO:0051607	0.947	defense response to virus
GO:0045087	0.929	innate immune response
GO:0050794	0.917	regulation of cellular process
GO:0034097	0.904	response to cytokine
GO:0052372	0.882	modulation by symbiont of entry into host
GO:0046596	0.866	regulation of viral entry into host cell
GO:0045069	0.862	regulation of viral genome replication
GO:0045071	0.532	negative regulation of viral genome replication
GO:0009987	0.531	cellular process
GO:0034341	0.432	response to type II interferon
GO:0051716	0.386	cellular response to stimulus
GO:0071345	0.339	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0005654	0.996	nucleoplasm
GO:0031090	0.992	organelle membrane
GO:0031982	0.989	vesicle
GO:0032991	0.988	protein-containing complex
GO:0097708	0.941	intracellular vesicle
GO:0031410	0.926	cytoplasmic vesicle
GO:0098588	0.878	bounding membrane of organelle
GO:0005773	0.843	vacuole
GO:0000323	0.825	lytic vacuole
GO:0005768	0.621	endosome
GO:0030054	0.518	cell junction
GO:0005829	0.514	cytosol
GO:0030659	0.492	cytoplasmic vesicle membrane
GO:0005764	0.461	lysosome
GO:0005774	0.418	vacuolar membrane
GO:0098852	0.393	lytic vacuole membrane
GO:0010008	0.387	endosome membrane
GO:0005765	0.375	lysosomal membrane
GO:0043232	0.343	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]