StarFunc result for job id C9JSJ3

User Input

>input (638 residues)
MFGSSRYLGSSEQPRANSLGPSDRTLVLCSLVEGEDKVNPSEPHGLRMEEKWLLKGKLRN
QRNQNKLLSPNKKQRKNHTSKLQELALLLPIALKTGTKKLTKKEILVHVLQYIQYLQRNI
DAAKALFKCHITTGEGGLAGLGQKPAWGPARRRRHSTPSSSPSSQKSCLQGACQKPRKKK
LTQASESQTRTPKPRRSLALNKPEKLVAPSPDQKGSGTGGTTTPPRCPDSCGHPRPASSS
PPGDRKGGQSQLTLLDLAEDTIHCDISSCWCQGSVQDDAPFPALLAQEDVARIHFLNKTQ
PHPRQKLVFYDSSEDVDKGSLDADPWLPAWTPENSPQGSPLFLGPPQIDVWSGTGHPSEI
LGLSPSLFSSPGKLLPDEILEDDMEYLTQAAFFEEVCLDLESSPSAYTQEAPQEKDTASK
APKDPPESHSLHRSSVSLDHCYLSLSGNSKAPSSSSSSSSSSSSSEDSDSEPLWKQREDM
QANPVGTPGSSEEDEDTTWTPTRLASPLLAAEKKATKGQVARAPVKPKEKKKGPCPPQMK
KKCVNGFIMFCRMNRKQYIRSCPGTASTAATKELAQLWRVMTQQERRPYCTKARRFSRQH
NRIVKQDGSSSEAEDWETPKPFYQLLAEKALPLPPHLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5K7RLP0	0.225	0.238	7.690E-32	589	0.472	0.511	A0A5K7RLP0.pdb.gz	MEIOS_MOUSE Meiosis initiator protein OS=Mus musculus OX=10090 GN=Meiosin PE=1 SV=1
2	PDB:1j5nA	0.097	0.580	9.279E-3	93	0.027	0.183	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
3	AFDB:Q9VUK7	0.074	0.075	1.259E-2	635	0.124	0.124	Q9VUK7.pdb.gz	Q9VUK7_DROME RE36140p OS=Drosophila melanogaster OX=7227 GN=sstn PE=2 SV=1
4	AFDB:J3KPH8	0.053	0.039	2.902E-2	1014	0.149	0.094	J3KPH8.pdb.gz	J3KPH8_HUMAN Histone deacetylase OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=1
5	AFDB:A0A0A0MSI2	0.075	0.060	5.269E-2	830	0.129	0.099	A0A0A0MSI2.pdb.gz	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
6	AFDB:Q9UQB3	0.070	0.044	5.269E-2	1225	0.147	0.077	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
7	AFDB:Q99550	0.058	0.038	1.289E-1	1183	0.150	0.081	Q99550.pdb.gz	MPP9_HUMAN M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9 PE=1 SV=6
8	AFDB:Q6K8X6	0.073	0.069	1.843E-1	688	0.143	0.132	Q6K8X6.pdb.gz	ORR23_ORYSJ Two-component response regulator ORR23 OS=Oryza sativa subsp. japonica OX=39947 GN=RR23 PE=2 SV=1
9	AFDB:O48683	0.084	0.097	1.957E-1	540	0.121	0.143	O48683.pdb.gz	O48683_ARATH F3I6.9 protein OS=Arabidopsis thaliana OX=3702 GN=At1g24160 PE=1 SV=1
10	AFDB:Q8IXK0	0.074	0.059	1.957E-1	858	0.150	0.112	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
11	AFDB:Q9LFI5	0.046	0.051	1.957E-1	553	0.110	0.127	Q9LFI5.pdb.gz	Q9LFI5_ARATH At3g53320 OS=Arabidopsis thaliana OX=3702 GN=GPT2 PE=1 SV=1
12	PDB:7ploI	0.075	0.105	5.043E-1	451	0.022	0.031	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7pubCI	0.064	0.090	3.400	427	0.031	0.047	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
14	PDB:4v8sAY	0.054	0.083	4.066	376	0.014	0.024	4v8sAY.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
15	PDB:5dgesM	0.037	0.129	4.316	104	0.031	0.192	5dgesM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
16	PDB:4jchA	0.048	0.068	5.162	436	0.009	0.014	4jchA.pdb.gz	Structure of OSH4 bound to an electrophilic oxysterol
17	PDB:3ojaA	0.071	0.088	5.479	482	0.017	0.023	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
18	PDB:7vkkA	0.051	0.091	5.816	287	0.019	0.042	7vkkA.pdb.gz
19	PDB:6nr7A	0.046	0.031	6.173	1086	0.036	0.021	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
20	PDB:1x6iA	0.042	0.197	6.552	89	0.009	0.067	1x6iA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5K7RLP0	7.98e-155	460	589	0.470	0.509	MEIOS_MOUSE Meiosis initiator protein OS=Mus musculus OX=10090 GN=Meiosin PE=1 SV=1
2	Q04891	3.94e-05	49.3	613	0.030	0.031	SOX13_MOUSE Transcription factor SOX-13 OS=Mus musculus OX=10090 GN=Sox13 PE=1 SV=4
3	Q9UN79	5.04e-05	48.9	622	0.030	0.031	SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens OX=9606 GN=SOX13 PE=1 SV=3
4	P57073	6.74e-05	48.1	446	0.063	0.090	SOX8_HUMAN Transcription factor SOX-8 OS=Homo sapiens OX=9606 GN=SOX8 PE=2 SV=1
5	O57396	2.31e-04	46.6	585	0.028	0.031	O57396_ONCMY RtSox23 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
6	Q90XD1	2.74e-04	46.2	485	0.025	0.033	Q90XD1_DANRE HMG-box transcription factor Sox10 OS=Danio rerio OX=7955 GN=cls/sox10 PE=2 SV=1
7	P57074	3.01e-04	46.2	470	0.027	0.036	SOX8_CHICK Transcription factor SOX-8 OS=Gallus gallus OX=9031 GN=SOX8 PE=2 SV=1
8	Q04886	3.02e-04	46.2	464	0.027	0.037	SOX8_MOUSE Transcription factor SOX-8 OS=Mus musculus OX=10090 GN=Sox8 PE=2 SV=2
9	Q3ZM07	3.92e-04	46.2	759	0.031	0.026	Q3ZM07_DANRE SRY-box-containing protein 5 OS=Danio rerio OX=7955 GN=id:ibd5067 PE=1 SV=1
10	O18896	4.22e-04	45.8	509	0.027	0.033	SOX9_PIG Transcription factor SOX-9 OS=Sus scrofa OX=9823 GN=SOX9 PE=2 SV=1
11	Q04887	4.24e-04	45.8	507	0.027	0.034	SOX9_MOUSE Transcription factor SOX-9 OS=Mus musculus OX=10090 GN=Sox9 PE=1 SV=2
12	Q6VVD7	4.24e-04	45.8	459	0.027	0.037	SOX8_XENLA Transcription factor Sox-8 OS=Xenopus laevis OX=8355 GN=sox8 PE=2 SV=1
13	P48436	4.25e-04	45.8	509	0.027	0.033	SOX9_HUMAN Transcription factor SOX-9 OS=Homo sapiens OX=9606 GN=SOX9 PE=1 SV=1
14	F1LYL9	4.43e-04	45.8	507	0.027	0.034	SOX9_RAT Transcription factor SOX-9 OS=Rattus norvegicus OX=10116 GN=Sox9 PE=1 SV=2
15	Q04892	4.47e-04	44.7	240	0.027	0.071	SOX14_MOUSE Transcription factor SOX-14 OS=Mus musculus OX=10090 GN=Sox14 PE=2 SV=2
16	Q8AXX8	4.54e-04	45.4	446	0.025	0.036	SOX10_XENLA Transcription factor Sox-10 OS=Xenopus laevis OX=8355 GN=sox10 PE=1 SV=1
17	O95416	4.64e-04	44.7	240	0.027	0.071	SOX14_HUMAN Transcription factor SOX-14 OS=Homo sapiens OX=9606 GN=SOX14 PE=1 SV=1
18	Q32PP9	4.91e-04	44.7	238	0.027	0.071	SOX14_DANRE Transcription factor Sox-14 OS=Danio rerio OX=7955 GN=sox14 PE=2 SV=1
19	P48434	4.98e-04	45.4	494	0.027	0.034	SOX9_CHICK Transcription factor SOX-9 OS=Gallus gallus OX=9031 GN=SOX9 PE=1 SV=3
20	Q9W7R6	5.08e-04	44.3	240	0.027	0.071	SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus OX=9031 GN=SOX14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	0.063	24.6	Helix-loop-helix DNA-binding domain
2	PF00505 HMG_box	8.6e-06	37.4	HMG (high mobility group) box
3	PF09011 HMG_box_2	2	20.4	HMG-box domain
4	PF04769 MATalpha_HMGbox	2.4e+02	12.4	Mating-type protein MAT alpha 1 HMG-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402674

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410007	0.653	F-box only protein 46
2	9606.ENSP00000316842	0.620	Homeobox protein SIX5
3	9606.ENSP00000270223	0.576	Dystrophia myotonica WD repeat-containing protein
4	9606.ENSP00000319179	0.529	Keratinocyte differentiation factor 1
5	9606.ENSP00000245934	0.506	Symplekin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.990	DNA binding
GO:0043565	0.910	sequence-specific DNA binding
GO:0003700	0.847	DNA-binding transcription factor activity
GO:0003690	0.837	double-stranded DNA binding
GO:1990837	0.794	sequence-specific double-stranded DNA binding
GO:0001216	0.712	DNA-binding transcription activator activity
GO:0000981	0.698	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.599	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.570	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.500	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0048518	0.979	positive regulation of biological process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0006355	0.967	regulation of DNA-templated transcription
GO:0048522	0.941	positive regulation of cellular process
GO:0009987	0.920	cellular process
GO:0032502	0.896	developmental process
GO:0032501	0.887	multicellular organismal process
GO:0006357	0.790	regulation of transcription by RNA polymerase II
GO:0048609	0.738	multicellular organismal reproductive process
GO:0051173	0.658	positive regulation of nitrogen compound metabolic process
GO:0031325	0.658	positive regulation of cellular metabolic process
GO:0010604	0.649	positive regulation of macromolecule metabolic process
GO:0048856	0.641	anatomical structure development
GO:0045944	0.559	positive regulation of transcription by RNA polymerase II
GO:0050896	0.392	response to stimulus
GO:0030154	0.346	cell differentiation
GO:0003006	0.303	developmental process involved in reproduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.966	nuclear lumen
GO:0043232	0.929	intracellular non-membrane-bounded organelle
GO:0005654	0.888	nucleoplasm
GO:0005737	0.746	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]