StarFunc result for job id C9JTQ0

User Input

>input (380 residues)
MLKPKDLCPRAGTRTFLEAMQAGKVHLARFVLDALDRSIIDCRAEQGRTPLMVAVGLPDP
ALRARFVRLLLEQGAAVNLRDERGRTALSLACERGHLDAVQLLVQFSGDPEAADSAGNSP
VMWAAACGHGAVLEFLVRSFRRLGLRLDRTNRAGLTALQLAAARGHGTCVQALTGPWGRA
AAAAAARGSNSDSPPGRPAPAASPEHRRPSPRRLPRPLLARFARAAGGHGGEAGSAGKNS
GRHRAQGSERPELGRSMSLALGAVTEEEAARLRAGALMALPNSPQSSGTGRWRSQEVLEG
APPTLAQAPIGLSPHPEGGPGSGRLGLRRRSTAPDIPSLVGEAPGPESGPELEANALSVS
VPGPNPWQAGTEAVVLRAQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULJ7	0.391	0.109	1.519E-9	1429	0.187	0.050	Q9ULJ7.pdb.gz	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
2	AFDB:Q9Y2G4	0.380	0.204	1.803E-8	727	0.218	0.114	Q9Y2G4.pdb.gz	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3
3	PDB:8cs9A	0.322	0.162	1.087E-7	796	0.132	0.063	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	PDB:1bd8A	0.366	0.847	3.578E-7	156	0.132	0.321	1bd8A.pdb.gz
5	PDB:4oauC	0.350	0.198	8.162E-7	692	0.132	0.072	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
6	AFDB:M9PFV2	0.255	0.161	1.337E-6	635	0.205	0.123	M9PFV2.pdb.gz	M9PFV2_DROME Myosin phosphatase targeting subunit 75D, isoform B OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=4 SV=1
7	PDB:2dvwA	0.373	0.608	1.481E-6	229	0.100	0.166	2dvwA.pdb.gz
8	PDB:1bu9A	0.365	0.767	2.040E-6	168	0.132	0.298	1bu9A.pdb.gz
9	PDB:6mwqA	0.352	0.274	5.340E-6	493	0.113	0.087	6mwqA.pdb.gz
10	PDB:1wg0A	0.348	0.534	9.253E-6	243	0.103	0.160	1wg0A.pdb.gz
11	PDB:5vkqA	0.367	0.097	1.398E-5	1499	0.105	0.027	5vkqA.pdb.gz
12	PDB:6pqpA	0.363	0.228	1.532E-5	615	0.108	0.067	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
13	PDB:6jd6B	0.359	0.682	1.926E-5	192	0.087	0.172	6jd6B.pdb.gz
14	AFDB:A1Z7A6	0.310	0.107	2.718E-4	1155	0.189	0.062	A1Z7A6.pdb.gz	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
15	AFDB:Q86A02	0.291	0.084	7.446E-4	1589	0.142	0.034	Q86A02.pdb.gz	Q86A02_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=PIPkinA PE=4 SV=1
16	AFDB:Q9SY69	0.094	0.053	4.543E-1	913	0.163	0.068	Q9SY69.pdb.gz	PPR29_ARATH Pentatricopeptide repeat-containing protein At1g10270 OS=Arabidopsis thaliana OX=3702 GN=GRP23 PE=1 SV=1
17	AFDB:Q9VS24	0.175	0.082	9.456E-1	994	0.182	0.069	Q9VS24.pdb.gz	MELT_DROME Protein melted OS=Drosophila melanogaster OX=7227 GN=melt PE=1 SV=2
18	AFDB:P04386	0.141	0.073	9.899E-1	881	0.137	0.059	P04386.pdb.gz	GAL4_YEAST Regulatory protein GAL4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL4 PE=1 SV=2
19	AFDB:Q8RWY6	0.175	0.068	1.428	1439	0.134	0.035	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
20	AFDB:Q9QYP2	0.104	0.030	2.157	2144	0.197	0.035	Q9QYP2.pdb.gz	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULJ7	1.12e-15	81.3	1429	0.142	0.038	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
2	Q86W74	2.64e-14	73.9	228	0.147	0.246	ANR46_HUMAN Ankyrin repeat domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ANKRD46 PE=1 SV=2
3	A0A0G2K7U7	2.20e-13	73.9	1062	0.153	0.055	A0A0G2K7U7_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
4	A0A8I5ZNY3	2.42e-13	73.9	988	0.153	0.059	A0A8I5ZNY3_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=1
5	A0A0G2JVS9	2.59e-13	73.9	997	0.153	0.058	A0A0G2JVS9_RAT Ankyrin repeat domain 27 OS=Rattus norvegicus OX=10116 GN=Ankrd27 PE=1 SV=2
6	Q9C0D5	3.75e-13	73.6	1861	0.116	0.024	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
7	Q0VGY8	5.36e-13	73.2	1856	0.113	0.023	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
8	Q96NW4	1.56e-12	71.6	1050	0.118	0.043	ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2
9	Q99NH0	2.08e-12	71.2	2603	0.129	0.019	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
10	O15084	2.42e-12	70.9	1053	0.132	0.047	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
11	A0A0G2K916	2.53e-12	70.9	2615	0.145	0.021	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
12	B0S4T9	2.77e-12	70.5	873	0.124	0.054	B0S4T9_DANRE Espin OS=Danio rerio OX=7955 GN=si:dkey-77h17.1 PE=4 SV=1
13	E9QEX9	3.13e-12	70.9	2607	0.103	0.015	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
14	A0A0R4IUB2	3.18e-12	70.9	2580	0.103	0.015	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
15	Q8IWZ3	3.53e-12	70.5	2542	0.103	0.015	ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1
16	A0A0S2Z6F4	4.09e-12	65.9	160	0.118	0.281	A0A0S2Z6F4_HUMAN Ankyrin repeat domain 50 isoform 2 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=1
17	D3J162	4.27e-12	69.7	541	0.145	0.102	VPY_MEDTR Protein VAPYRIN OS=Medicago truncatula OX=3880 GN=VPY PE=1 SV=1
18	Q8N8A2	5.12e-12	69.7	993	0.153	0.058	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
19	Q3UMR0	6.00e-12	69.7	1048	0.150	0.054	ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus OX=10090 GN=Ankrd27 PE=1 SV=2
20	H0YM23	9.39e-12	69.3	2487	0.129	0.020	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.2e-10	51.7	Ankyrin repeat
2	PF12796 Ank_2	7.8e-18	76.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.3e-12	55.1	Ankyrin repeat
4	PF13637 Ank_4	1.6e-14	65.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.9e-13	61.6	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314480	0.617	Homeobox protein unc-4 homolog
2	9606.ENSP00000481038	0.529	Cytoplasmic FMR1-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0009987	0.985	cellular process
GO:0050794	0.973	regulation of cellular process
GO:0032501	0.962	multicellular organismal process
GO:0032502	0.939	developmental process
GO:0048856	0.927	anatomical structure development
GO:0050896	0.926	response to stimulus
GO:0007275	0.888	multicellular organism development
GO:0048518	0.862	positive regulation of biological process
GO:0048522	0.843	positive regulation of cellular process
GO:0048731	0.841	system development
GO:0051128	0.830	regulation of cellular component organization
GO:0048869	0.779	cellular developmental process
GO:0030154	0.769	cell differentiation
GO:0051716	0.723	cellular response to stimulus
GO:0019222	0.642	regulation of metabolic process
GO:0044087	0.632	regulation of cellular component biogenesis
GO:0051130	0.579	positive regulation of cellular component organization
GO:0009653	0.570	anatomical structure morphogenesis
GO:0007399	0.570	nervous system development
GO:0048699	0.556	generation of neurons
GO:0060255	0.543	regulation of macromolecule metabolic process
GO:0030182	0.513	neuron differentiation
GO:0031323	0.506	regulation of cellular metabolic process
GO:0016043	0.443	cellular component organization
GO:0048468	0.432	cell development
GO:0050793	0.409	regulation of developmental process
GO:0000902	0.400	cell morphogenesis
GO:0010468	0.400	regulation of gene expression
GO:0007154	0.395	cell communication
GO:0080090	0.388	regulation of primary metabolic process
GO:0051171	0.387	regulation of nitrogen compound metabolic process
GO:0030030	0.376	cell projection organization
GO:0048666	0.375	neuron development
GO:0031326	0.372	regulation of cellular biosynthetic process
GO:0010556	0.367	regulation of macromolecule biosynthetic process
GO:0031175	0.366	neuron projection development
GO:0003008	0.365	system process
GO:0048519	0.358	negative regulation of biological process
GO:0120035	0.352	regulation of plasma membrane bounded cell projection organization
GO:0000904	0.339	cell morphogenesis involved in differentiation
GO:0010646	0.336	regulation of cell communication
GO:0048523	0.332	negative regulation of cellular process
GO:0051495	0.325	positive regulation of cytoskeleton organization
GO:0050877	0.321	nervous system process
GO:0048858	0.310	cell projection morphogenesis
GO:0110053	0.306	regulation of actin filament organization
GO:0048812	0.304	neuron projection morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0031981	0.993	nuclear lumen
GO:0005829	0.974	cytosol
GO:0005654	0.968	nucleoplasm
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0032991	0.323	protein-containing complex
GO:0012505	0.321	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]