StarFunc result for job id C9JVW0

User Input

>input (142 residues)
MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRS
PAAPAGPQPSAPSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDP
DRRPSRQTPRETPEAAEGRRPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9R187	0.248	0.093	2.661E-1	448	0.176	0.056	Q9R187.pdb.gz	EDAR_MOUSE Tumor necrosis factor receptor superfamily member EDAR OS=Mus musculus OX=10090 GN=Edar PE=1 SV=1
2	AFDB:Q9NYG8	0.186	0.082	4.699E-1	393	0.232	0.084	Q9NYG8.pdb.gz	KCNK4_HUMAN Potassium channel subfamily K member 4 OS=Homo sapiens OX=9606 GN=KCNK4 PE=1 SV=2
3	AFDB:P52591	0.205	0.034	7.197E-1	1199	0.289	0.034	P52591.pdb.gz	PO121_RAT Nuclear envelope pore membrane protein POM 121 OS=Rattus norvegicus OX=10116 GN=Pom121 PE=1 SV=1
4	AFDB:Q9BWF3	0.201	0.084	8.296E-1	364	0.169	0.066	Q9BWF3.pdb.gz	RBM4_HUMAN RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1
5	AFDB:O08625	0.217	0.068	1.027	523	0.197	0.054	O08625.pdb.gz	SYT10_RAT Synaptotagmin-10 OS=Rattus norvegicus OX=10116 GN=Syt10 PE=2 SV=2
6	AFDB:O42861	0.129	0.031	1.184	922	0.141	0.022	O42861.pdb.gz	FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fft3 PE=1 SV=1
7	AFDB:P56975	0.190	0.043	1.184	720	0.211	0.042	P56975.pdb.gz	NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG3 PE=1 SV=1
8	AFDB:O75022	0.198	0.051	1.271	631	0.176	0.040	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q9VI75	0.188	0.081	1.271	468	0.218	0.066	Q9VI75.pdb.gz	PICAL_DROME Phosphatidylinositol-binding clathrin assembly protein LAP OS=Drosophila melanogaster OX=7227 GN=lap PE=1 SV=3
10	AFDB:A0A0R4IE04	0.210	0.038	1.364	940	0.176	0.027	A0A0R4IE04.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6DUH4	0.004	38.5	1597	0.183	0.016	Q6DUH4_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=2 SV=1
2	A0A8I6ARN7	0.008	37.7	1579	0.176	0.016	A0A8I6ARN7_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
3	E9PTG1	0.008	37.7	1597	0.176	0.016	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
4	A0A0G2JUS4	0.012	37.0	1488	0.176	0.017	A0A0G2JUS4_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=2
5	Q6Y7W8	0.030	36.2	1291	0.141	0.015	GGYF2_MOUSE GRB10-interacting GYF protein 2 OS=Mus musculus OX=10090 GN=Gigyf2 PE=1 SV=2
6	Q6ZQF0	0.070	35.0	1515	0.134	0.013	TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus OX=10090 GN=Topbp1 PE=1 SV=2
7	Q08DF4	0.086	34.7	856	0.127	0.021	DYN1_BOVIN Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1
8	Q6DIC0	0.12	34.3	1577	0.176	0.016	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
9	P39053	0.34	32.7	867	0.120	0.020	DYN1_MOUSE Dynamin-1 OS=Mus musculus OX=10090 GN=Dnm1 PE=1 SV=2
10	P21575	0.53	32.3	864	0.113	0.019	DYN1_RAT Dynamin-1 OS=Rattus norvegicus OX=10116 GN=Dnm1 PE=1 SV=2
11	Q05193	0.53	32.3	864	0.113	0.019	DYN1_HUMAN Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1 PE=1 SV=2
12	Q9Y6X9	0.53	32.3	1032	0.211	0.029	MORC2_HUMAN ATPase MORC2 OS=Homo sapiens OX=9606 GN=MORC2 PE=1 SV=2
13	P39054	0.79	32.0	870	0.155	0.025	DYN2_MOUSE Dynamin-2 OS=Mus musculus OX=10090 GN=Dnm2 PE=1 SV=2
14	Q08877	0.99	31.6	869	0.106	0.017	DYN3_RAT Dynamin-3 OS=Rattus norvegicus OX=10116 GN=Dnm3 PE=1 SV=2
15	P39052	1.0	31.6	870	0.155	0.025	DYN2_RAT Dynamin-2 OS=Rattus norvegicus OX=10116 GN=Dnm2 PE=1 SV=1
16	Q9UQ16	1.1	31.6	869	0.134	0.022	DYN3_HUMAN Dynamin-3 OS=Homo sapiens OX=9606 GN=DNM3 PE=1 SV=4
17	A0A0R4IIR1	1.5	30.8	860	0.197	0.033	A0A0R4IIR1_DANRE dynamin GTPase OS=Danio rerio OX=7955 GN=dnm2 PE=1 SV=1
18	T1SXK0	1.5	30.8	856	0.197	0.033	T1SXK0_DANRE dynamin GTPase OS=Danio rerio OX=7955 GN=dnm2 PE=1 SV=1
19	Q8BZ98	2.1	30.4	863	0.134	0.022	DYN3_MOUSE Dynamin-3 OS=Mus musculus OX=10090 GN=Dnm3 PE=1 SV=1
20	Q9JL26	2.7	30.4	1094	0.092	0.012	FMNL1_MOUSE Formin-like protein 1 OS=Mus musculus OX=10090 GN=Fmnl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15018 InaF-motif	4.1e-11	53.9	TRP-interacting helix

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447679

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394510	0.658	Proline-rich protein 12
2	9606.ENSP00000299736	0.567	Centromere protein V
3	9606.ENSP00000313422	0.531	ADP-ribosylation factor-like protein 6-interacting protein 4
4	9606.ENSP00000341094	0.505	Histone H2A type 1-D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0065007	0.976	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0050794	0.801	regulation of cellular process
GO:0048518	0.341	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.988	membrane
GO:0043226	0.870	organelle
GO:0005622	0.864	intracellular anatomical structure
GO:0071944	0.859	cell periphery
GO:0043229	0.840	intracellular organelle
GO:0043227	0.816	membrane-bounded organelle
GO:0005886	0.748	plasma membrane
GO:0012505	0.559	endomembrane system
GO:0043231	0.443	intracellular membrane-bounded organelle
GO:0005737	0.383	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]