StarFunc result for job id D6RBM5

User Input

>input (183 residues)
MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRH
KGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGH
KQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0WX57	0.616	0.220	1.601E-23	530	0.989	0.342	Q0WX57.pdb.gz	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	AFDB:Q9H9J4	0.536	0.077	1.621E-11	1324	0.464	0.064	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
3	AFDB:B2RQC2	0.536	0.077	1.101E-10	1324	0.459	0.063	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
4	AFDB:G5E8G2	0.605	0.214	2.003E-9	545	0.415	0.139	G5E8G2.pdb.gz	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
5	AFDB:E9Q9U0	0.540	0.218	3.104E-9	468	0.393	0.154	E9Q9U0.pdb.gz	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
6	AFDB:Q7M764	0.575	0.199	3.279E-9	540	0.399	0.135	Q7M764.pdb.gz	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
7	AFDB:A0A024R8V6	0.535	0.092	3.463E-9	1123	0.404	0.066	A0A024R8V6.pdb.gz
8	AFDB:B1AQJ2	0.532	0.093	6.324E-9	1098	0.372	0.062	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
9	AFDB:E7F4C0	0.590	0.109	1.361E-8	1104	0.388	0.064	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
10	AFDB:X2JLM6	0.490	0.171	1.877E-6	565	0.268	0.087	X2JLM6.pdb.gz	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
11	PDB:3mhsA	0.430	0.182	2.855E-4	455	0.164	0.066	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:5k16B	0.447	0.259	9.518E-4	328	0.164	0.091	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:5cvnB	0.447	0.265	1.062E-3	321	0.153	0.087	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
14	PDB:4wa6D	0.406	0.192	1.396E-3	415	0.153	0.067	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
15	PDB:4fjcE	0.368	0.169	3.951E-3	434	0.137	0.058	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	PDB:5mpc8	0.422	0.209	8.501E-3	395	0.148	0.068	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:7qo48	0.418	0.221	2.156E-2	372	0.158	0.078	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
18	PDB:7w3ax	0.399	0.164	2.277E-2	494	0.120	0.045	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
19	PDB:5gjqx	0.404	0.218	2.684E-2	355	0.126	0.065	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:7ay1D	0.397	0.228	3.727E-2	341	0.142	0.076	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6QN14	2.21e-134	383	398	0.989	0.455	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
2	Q0WX57	8.28e-133	384	530	0.989	0.342	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
3	Q6R6M4	3.54e-124	362	530	0.945	0.326	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
4	Q9H9J4	4.08e-49	172	1324	0.481	0.066	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
5	B2RQC2	7.08e-49	171	1324	0.481	0.066	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
6	E9Q9U0	2.71e-44	154	468	0.432	0.169	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
7	Q7M764	2.85e-43	152	540	0.443	0.150	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
8	E9PEW0	2.75e-42	150	548	0.393	0.131	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
9	G5E8G2	8.33e-42	149	545	0.421	0.141	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
10	G5E8I7	9.82e-42	149	545	0.421	0.141	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
11	Q9P275	3.24e-41	149	1123	0.393	0.064	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
12	Q61068	4.59e-41	146	526	0.421	0.146	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
13	E7F4C0	3.02e-40	146	1104	0.415	0.069	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
14	B1AQJ2	2.11e-39	144	1098	0.372	0.062	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
15	O74442	1.80e-27	108	457	0.339	0.136	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
16	Q9SB51	9.94e-20	87.8	1008	0.208	0.038	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
17	Q9VRP5	1.05e-17	82.0	1038	0.273	0.048	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
18	Q9FPS9	1.75e-16	78.6	924	0.213	0.042	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
19	F4I642	1.82e-16	78.6	928	0.213	0.042	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
20	Q9FIQ1	3.11e-16	77.8	732	0.230	0.057	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	3.9e-14	64.4	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	0.0039	28.5	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381386	0.614	D-dopachrome decarboxylase
2	9606.ENSP00000389513	0.601	Cancer/testis antigen family 47, member A4
3	9606.ENSP00000392283	0.601	Cancer/testis antigen family 47, member A7
4	9606.ENSP00000393315	0.601	Cancer/testis antigen family 47, member A1
5	9606.ENSP00000398559	0.601	Cancer/testis antigen family 47, member A3
6	9606.ENSP00000399711	0.601	Cancer/testis antigen family 47, member A6
7	9606.ENSP00000400046	0.601	Cancer/testis antigen family 47, member A8
8	9606.ENSP00000408204	0.601	Cancer/testis antigen family 47, member A9
9	9606.ENSP00000410400	0.601	Cancer/testis antigen family 47, member A11
10	9606.ENSP00000411909	0.601	Cancer/testis antigen family 47, member A10
11	9606.ENSP00000414253	0.601	Cancer/testis antigen family 47, member A2
12	9606.ENSP00000414509	0.601	Cancer/testis antigen family 47, member A12
13	9606.ENSP00000381703	0.521	Beta-defensin 113

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	0.999	cysteine-type deubiquitinase activity
GO:0005488	0.998	binding
GO:0005515	0.977	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019538	0.982	protein metabolic process
GO:0006508	0.941	proteolysis
GO:0070647	0.937	protein modification by small protein conjugation or removal
GO:0016579	0.901	protein deubiquitination
GO:0065007	0.886	biological regulation
GO:0050789	0.880	regulation of biological process
GO:0050794	0.827	regulation of cellular process
GO:0048518	0.559	positive regulation of biological process
GO:0019222	0.555	regulation of metabolic process
GO:0048522	0.552	positive regulation of cellular process
GO:0060255	0.547	regulation of macromolecule metabolic process
GO:0048519	0.536	negative regulation of biological process
GO:0048523	0.528	negative regulation of cellular process
GO:0048583	0.463	regulation of response to stimulus
GO:0023051	0.462	regulation of signaling
GO:0010646	0.448	regulation of cell communication
GO:0009966	0.441	regulation of signal transduction
GO:0010468	0.347	regulation of gene expression
GO:0032103	0.327	positive regulation of response to external stimulus
GO:0031349	0.327	positive regulation of defense response
GO:0009987	0.310	cellular process
GO:0002682	0.310	regulation of immune system process
GO:0009967	0.309	positive regulation of signal transduction
GO:0030334	0.303	regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.996	cytoplasm
GO:0031981	0.926	nuclear lumen
GO:0005654	0.684	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.

[back to server]