StarFunc result for job id D6RGH6

User Input

>input (385 residues)
MQACGGGAAGRRAFDSICPNRMLALPGRALLCKPGKPERKFAPPRKFFPGCTGGSPVSVY
EDPPDAEPTALPALTTIDLQDLADCSSLLGSDAPPGGDLAASQNHSHQTEADFNLQDFRD
TVDDLISDSSSMMSPTLASGDFPFSPCDISPFGPCLSPPLDPRALQSPPLRPPDVPPPEQ
YWKEVADQNQRALGDALVENNQLHVTLTQKQEEIASLKERNVQLKELASRTRHLASVLDK
LMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEVDAILREISERCDEALQSRDP
KRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRT
LAFPQGNAFTIRTANGGYKFRWVPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D6RGH6	1.000	1.000	1.203E-61	385	1.000	1.000	D6RGH6.pdb.gz	MCIN_HUMAN Multicilin OS=Homo sapiens OX=9606 GN=MCIDAS PE=1 SV=1
2	AFDB:Q3UZ45	0.239	0.242	4.301E-43	379	0.779	0.792	Q3UZ45.pdb.gz	MCIN_MOUSE Multicilin OS=Mus musculus OX=10090 GN=Mcidas PE=1 SV=1
3	AFDB:Q08B36	0.217	0.223	3.628E-24	374	0.475	0.489	Q08B36.pdb.gz	MCIN_XENLA Multicilin OS=Xenopus laevis OX=8355 GN=mcidas PE=1 SV=2
4	AFDB:Q9LNE0	0.111	0.102	6.873E-3	423	0.148	0.135	Q9LNE0.pdb.gz	Q9LNE0_ARATH At1g06070 OS=Arabidopsis thaliana OX=3702 GN=BZIP69 PE=1 SV=1
5	AFDB:B3DJ06	0.112	0.129	7.342E-3	328	0.135	0.159	B3DJ06.pdb.gz
6	AFDB:P18289	0.171	0.215	1.245E-2	289	0.109	0.145	P18289.pdb.gz	JRA_DROME Transcription factor Jra OS=Drosophila melanogaster OX=7227 GN=Jra PE=1 SV=2
7	AFDB:Q382V3	0.103	0.080	1.421E-2	536	0.148	0.106	Q382V3.pdb.gz	Q382V3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4100 PE=4 SV=1
8	AFDB:Q925B0	0.160	0.181	1.518E-2	333	0.114	0.132	Q925B0.pdb.gz	PAWR_MOUSE PRKC apoptosis WT1 regulator protein OS=Mus musculus OX=10090 GN=Pawr PE=1 SV=2
9	AFDB:Q657A4	0.084	0.087	2.750E-2	370	0.169	0.176	Q657A4.pdb.gz	Q657A4_ORYSJ Regulatory protein B-Peru-like OS=Oryza sativa subsp. japonica OX=39947 GN=P0013G02.6 PE=3 SV=1
10	AFDB:A7SXY9	0.093	0.097	3.138E-2	367	0.148	0.155	A7SXY9.pdb.gz	A7SXY9_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g248021 PE=1 SV=1
11	PDB:7mq8L8	0.058	0.102	1.189	180	0.023	0.050	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:4v6wAI	0.050	0.090	1.271	207	0.023	0.043	4v6wAI.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:5datS8	0.048	0.097	1.271	188	0.018	0.037	5datS8.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
14	PDB:5iy6S	0.073	0.152	2.627	138	0.026	0.072	5iy6S.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
15	PDB:7pzyJ	0.048	0.081	2.627	203	0.021	0.039	7pzyJ.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:2jkfA	0.049	0.107	3.421	170	0.005	0.012	2jkfA.pdb.gz
17	PDB:7dvqX	0.046	0.107	3.421	156	0.021	0.051	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:5wyjSJ	0.048	0.107	3.904	170	0.018	0.041	5wyjSJ.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
19	PDB:7mbyR	0.052	0.070	3.904	283	0.005	0.007	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
20	PDB:3cirA	0.057	0.041	4.170	541	0.016	0.011	3cirA.pdb.gz	A threonine on the active site loop controls transition state formation in Escherichia coli respiratory complex II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RGH6	0.0	782	385	1.000	1.000	MCIN_HUMAN Multicilin OS=Homo sapiens OX=9606 GN=MCIDAS PE=1 SV=1
2	Q3UZ45	0.0	580	379	0.782	0.794	MCIN_MOUSE Multicilin OS=Mus musculus OX=10090 GN=Mcidas PE=1 SV=1
3	Q08B36	4.66e-106	318	374	0.473	0.487	MCIN_XENLA Multicilin OS=Xenopus laevis OX=8355 GN=mcidas PE=1 SV=2
4	O88513	7.71e-12	66.2	206	0.078	0.146	GEMI_MOUSE Geminin OS=Mus musculus OX=10090 GN=Gmnn PE=1 SV=1
5	E2QRF9	1.24e-11	65.1	179	0.075	0.162	E2QRF9_HUMAN Geminin DNA replication inhibitor (Fragment) OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1
6	O75496	1.33e-11	65.5	209	0.075	0.139	GEMI_HUMAN Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1
7	Q5ZKE6	5.94e-11	63.2	187	0.078	0.160	Q5ZKE6_CHICK Geminin OS=Gallus gallus OX=9031 GN=RCJMB04_11f7 PE=2 SV=1
8	B0LHV2	7.63e-11	63.5	224	0.078	0.134	B0LHV2_CHICK Truncated geminin OS=Gallus gallus OX=9031 PE=2 SV=1
9	O93352	3.33e-10	61.6	219	0.073	0.128	O93352_XENLA GMNN protein OS=Xenopus laevis OX=8355 GN=gmnn.S PE=1 SV=1
10	D3YN49	1.50e-09	60.8	316	0.174	0.212	GEMC1_XENLA Geminin coiled-coil domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gmnc PE=1 SV=1
11	Q7SXL0	1.71e-09	60.1	241	0.073	0.116	Q7SXL0_DANRE Geminin OS=Danio rerio OX=7955 GN=sb:cb254 PE=2 SV=1
12	Q709D5	1.43e-08	57.0	233	0.065	0.107	Q709D5_ORYLA Geminin OS=Oryzias latipes OX=8090 PE=2 SV=1
13	E7FDS4	1.03e-04	46.2	382	0.047	0.047	E7FDS4_DANRE Geminin coiled-coil domain-containing OS=Danio rerio OX=7955 GN=gmnc PE=4 SV=1
14	A6NCL1	1.73e-04	45.4	334	0.047	0.054	GEMC1_HUMAN Geminin coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GMNC PE=1 SV=2
15	Q3URY2	1.82e-04	45.4	333	0.047	0.054	GEMC1_MOUSE Geminin coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gmnc PE=2 SV=1
16	Q69ZU8	0.14	37.0	712	0.044	0.024	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
17	E5RJ05	0.18	35.8	230	0.042	0.070	E5RJ05_HUMAN Ankyrin repeat domain 6 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD6 PE=1 SV=1
18	Q9UQC9	0.25	36.2	943	0.091	0.037	CLCA2_HUMAN Calcium-activated chloride channel regulator 2 OS=Homo sapiens OX=9606 GN=CLCA2 PE=1 SV=2
19	Q7JX41	0.27	35.0	192	0.055	0.109	Q7JX41_DROME Geminin OS=Drosophila melanogaster OX=7227 GN=geminin PE=1 SV=1
20	Q9Y2G4	0.30	35.8	727	0.042	0.022	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13563 2_5_RNA_ligase2	62	15.0	2'-5' RNA ligase superfamily
2	PF04977 DivIC	4.3e+02	12.1	Septum formation initiator
3	PF07412 Geminin	2.4e-14	65.0	Geminin
4	PF17111 Helo_like_N	7.3e+02	10.9	Fungal N-terminal domain of STAND proteins

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426359

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368686	0.984	Transcription factor E2F4
2	9606.ENSP00000282572	0.913	Cyclin-O
3	9606.ENSP00000230056	0.902	Geminin
4	9606.ENSP00000301019	0.873	DNA replication factor Cdt1
5	9606.ENSP00000323880	0.857	Forkhead box protein J1
6	9606.ENSP00000406164	0.845	Geminin coiled-coil domain-containing protein 1
7	9606.ENSP00000293889	0.819	Coiled-coil domain-containing protein 78
8	9606.ENSP00000306335	0.819	DNA-binding protein RFX2
9	9606.ENSP00000371434	0.711	Transcription factor RFX3
10	9606.ENSP00000229554	0.683	Radial spoke head protein 4 homolog A
11	9606.ENSP00000278070	0.682	Peroxisome proliferator-activated receptor gamma coactivator-related protein 1
12	9606.ENSP00000288710	0.670	Dynein regulatory complex protein 1
13	9606.ENSP00000370781	0.644	Cell division cycle protein 20 homolog B
14	9606.ENSP00000291536	0.641	Radial spoke head 1 homolog
15	9606.ENSP00000361238	0.639	Radial spoke head 9 homolog
16	9606.ENSP00000298050	0.630	Deuterosome assembly protein 1
17	9606.ENSP00000313851	0.622	Sister chromatid cohesion protein PDS5 homolog B
18	9606.ENSP00000209728	0.617	Cell division control protein 6 homolog
19	9606.ENSP00000377197	0.608	Hydrocephalus-inducing protein homolog
20	9606.ENSP00000405708	0.606	Coiled-coil domain-containing protein 39

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0030030	0.990	cell projection organization
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0006996	0.989	organelle organization
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0019219	0.984	regulation of nucleobase-containing compound metabolic process
GO:0060271	0.981	cilium assembly
GO:0006275	0.930	regulation of DNA replication
GO:0044458	0.929	motile cilium assembly
GO:1902115	0.915	regulation of organelle assembly
GO:0090329	0.810	regulation of DNA-templated DNA replication
GO:1902017	0.783	regulation of cilium assembly
GO:0030174	0.782	regulation of DNA-templated DNA replication initiation
GO:0051726	0.770	regulation of cell cycle
GO:0007346	0.588	regulation of mitotic cell cycle
GO:0000226	0.311	microtubule cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.992	nucleoplasm
GO:0016604	0.606	nuclear body
GO:0043232	0.423	intracellular non-membrane-bounded organelle
GO:0005737	0.392	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]