StarFunc result for job id D6RGX4

User Input

>input (464 residues)
MMACRDPKPGAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHMARSTRCP
MKCWKAALVPPTLGKKEGKENLKPWKPQVEANPGPLNKDKGEKEERPRQQDPQRKALLHI
FSGKPPEKPLPNRKGSTESSVYLRVASGPMPVHTTSKRPRVDPVLADRSATEMSDRGSAL
ASLSPLRKASLSSSSSLGPKERQTGAAADIPQPAVRHQGPEPLLVVKPTHSSPEGGCREV
PQAASKTHGLLQAISPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPEYLQPPPATTELGPSTSPQMGRRTPAQVSSVD
RQPPHSRPCLPTAQACTMSHHPATSHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEVPRVRVPPNVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.314	0.314	3.028E-59	464	0.935	0.935	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:Q5U303	0.064	0.050	1.788E-1	693	0.164	0.110	Q5U303.pdb.gz	TAB2_RAT TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Tab2 PE=2 SV=2
3	AFDB:O94358	0.064	0.041	3.072E-1	845	0.164	0.090	O94358.pdb.gz	YHOA_SCHPO Uncharacterized protein C428.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC428.10 PE=1 SV=2
4	AFDB:Q6FUW3	0.071	0.040	3.517E-1	975	0.140	0.067	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
5	AFDB:Q8CHC8	0.060	0.032	9.069E-1	1165	0.181	0.072	Q8CHC8.pdb.gz	ADNP2_MOUSE Activity-dependent neuroprotector homeobox protein 2 OS=Mus musculus OX=10090 GN=Adnp2 PE=1 SV=2
6	AFDB:H3BJD0	0.076	0.043	1.272	977	0.151	0.072	H3BJD0.pdb.gz	H3BJD0_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
7	AFDB:Q924W6	0.070	0.031	1.558	1242	0.179	0.067	Q924W6.pdb.gz	TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus OX=10090 GN=Trim66 PE=1 SV=4
8	PDB:6edtJ	0.061	0.165	1.592	109	0.034	0.147	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
9	PDB:7p5xAJ	0.054	0.263	1.703	89	0.030	0.157	7p5xAJ.pdb.gz	Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
10	AFDB:A0A0R4ICG0	0.076	0.032	1.784	1387	0.218	0.073	A0A0R4ICG0.pdb.gz	A0A0R4ICG0_DANRE Period 1 isoform X1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=1
11	AFDB:F4HS99	0.098	0.032	1.784	1797	0.136	0.035	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
12	AFDB:Q4FZB7	0.063	0.036	2.186	885	0.170	0.089	Q4FZB7.pdb.gz	KMT5B_HUMAN Histone-lysine N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5B PE=1 SV=5
13	PDB:3zqjF	0.046	0.036	2.233	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
14	PDB:5hutA	0.032	0.032	2.233	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
15	PDB:3sucA	0.044	0.028	3.132	767	0.015	0.009	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
16	PDB:6i9ra	0.044	0.209	3.351	83	0.017	0.096	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
17	PDB:6gwjD	0.048	0.319	3.585	48	0.009	0.083	6gwjD.pdb.gz	Defects in t 6 A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome.
18	PDB:7y9tA	0.046	0.055	3.585	380	0.017	0.021	7y9tA.pdb.gz
19	PDB:7mq8L8	0.039	0.097	3.836	180	0.013	0.033	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7qdsA	0.053	0.125	4.105	155	0.026	0.077	7qdsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	820	464	0.935	0.935	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03348	0.17	36.6	512	0.054	0.049	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
3	P03347	0.29	36.2	512	0.054	0.049	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
4	P35963	0.30	36.2	1435	0.052	0.017	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
5	P05888	0.38	35.8	507	0.052	0.047	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
6	P04591	0.39	35.4	500	0.054	0.050	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
7	Q77YG1	0.39	35.4	500	0.054	0.050	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
8	P04590	0.44	35.4	522	0.095	0.084	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
9	Q7TMB7	0.60	35.0	766	0.034	0.021	PLPR4_RAT Phospholipid phosphatase-related protein type 4 OS=Rattus norvegicus OX=10116 GN=Plppr4 PE=1 SV=1
10	Q72497	0.62	35.0	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	0.63	35.0	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	Q8IZX4	0.95	34.7	1826	0.086	0.022	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
13	A0A8I6A7M0	1.5	33.9	1893	0.026	0.006	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
14	A0A8I6A7N8	1.5	33.9	1837	0.026	0.007	A0A8I6A7N8_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
15	Q80UV9	1.5	33.9	1891	0.026	0.006	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2
16	P21675	1.6	33.9	1872	0.026	0.006	TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens OX=9606 GN=TAF1 PE=1 SV=3
17	Q1LYC2	1.6	33.9	1947	0.026	0.006	Q1LYC2_DANRE Transcription initiation factor TFIID subunit OS=Danio rerio OX=7955 GN=wu:fi04f03 PE=1 SV=1
18	Q60544	1.6	33.9	1865	0.026	0.006	TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus OX=10036 GN=TAF1 PE=2 SV=1
19	P34652	1.7	33.5	619	0.039	0.029	CALX_CAEEL Calnexin OS=Caenorhabditis elegans OX=6239 GN=cnx-1 PE=1 SV=1
20	G5EF97	1.9	33.5	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14803 Nudix_N_2	5.4e+02	12.0	Nudix N-terminal
2	PF00098 zf-CCHC	14	17.1	Zinc knuckle
3	PF15288 zf-CCHC_6	4.1e-19	79.5	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.415	catalytic activity
GO:0016740	0.302	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0050794	0.963	regulation of cellular process
GO:0019222	0.867	regulation of metabolic process
GO:0043170	0.861	macromolecule metabolic process
GO:0031323	0.861	regulation of cellular metabolic process
GO:0019219	0.846	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.836	regulation of macromolecule metabolic process
GO:0048518	0.807	positive regulation of biological process
GO:0048522	0.789	positive regulation of cellular process
GO:0051252	0.736	regulation of RNA metabolic process
GO:0009893	0.721	positive regulation of metabolic process
GO:0031325	0.713	positive regulation of cellular metabolic process
GO:0010468	0.691	regulation of gene expression
GO:0031326	0.684	regulation of cellular biosynthetic process
GO:0010556	0.680	regulation of macromolecule biosynthetic process
GO:2001141	0.671	regulation of RNA biosynthetic process
GO:0006355	0.664	regulation of DNA-templated transcription
GO:0044260	0.653	cellular macromolecule metabolic process
GO:0010604	0.624	positive regulation of macromolecule metabolic process
GO:0051173	0.603	positive regulation of nitrogen compound metabolic process
GO:0045935	0.583	positive regulation of nucleobase-containing compound metabolic process
GO:1901564	0.478	organonitrogen compound metabolic process
GO:0006139	0.457	nucleobase-containing compound metabolic process
GO:1902680	0.435	positive regulation of RNA biosynthetic process
GO:0045893	0.429	positive regulation of DNA-templated transcription
GO:0090304	0.370	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0043233	0.975	organelle lumen
GO:0005654	0.969	nucleoplasm
GO:0043232	0.952	intracellular non-membrane-bounded organelle
GO:0005694	0.902	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.302	Transferases.

[back to server]