StarFunc result for job id D6RIA3

User Input

>input (1793 residues)
MLSFHFWKSRGQPTDAASSVADGIQTPRCCRRCQANNWTGQLSYRTLATVSAGAAAPQPQ
TTSTASSRSLPTSLRLAAAPPQGLKNWEVVAAVAAVPTALGPVQIRGTLLRATLQPLRGQ
RRTQDFPSDHHCLFLSLKPGQGLIMEAAPPELNSKARQAEVGDGVSSAQDSQELKQQLWP
LPKPSASSQREAKYVDMCASAEVQRESPQTMKLTLGHCPGGQRASRSPKEKAQDEPSSKT
PSPQNNPASSQLSRSQHSASEEGGNFSSSSSSSPMNKAEEDGLSKMEDSTTSTGALATSS
SSLGFESESGESEGCQAVGGEGEKISGGGGGGKGGGGGGAGDGTECRDIIAKSQGSRDPP
KVEEAHYITTHEIQLSEVEQDMDFDVGLASRWDFEDNNVIYSFVDYASFGGSDETPGDIT
SLTEEDDDNSCYLSTTPSTNTTRTPSPTSSDLARPNAGRSGRDTSSTEVGSGPSDSGPTP
PPTGPGTAPLTEPLPETPEAASGAAAAAASSCGSAASQILLSIKPASRAINEPSNVRAKQ
NIIYAAKHEGDMSLRVSTAAEHNSSSLKQNPAAAVAQDHAKKFIAVPARLQTRCGAIRAK
ELVDYSSGASSAVSELDDADKEVRNLTSRAFRSLAYPYFEALNISSRESSTTLSEVGFGR
WSTFLDLKCGGVGARVEQSLLRSSAASVAAGLRKGSGARATADQLYIQSKKSQTKALEFV
VSKVEGEIKHVETPLCFQKQVQTGSRVVTLLEPLNVRSESKASSAPGPGRATKGPGKGPG
SAYTDDGSETSEGSKPTSRADGPQKSKFASSLLKNVISKKMQREHEFKMERGEVMDTSHH
LSGTSKETEGARGSERQRERGLQRQSSRHSEAGSEYTVVSMSDAGGEGSVAGSKSPVFKA
STPRERNAGPGRNFTDGHTEVCEIKKSASETVKGIFLRSQNSAFRSWKEKEAEKREEQAP
IGKLKLPKGGDWRADLGEISASKNTIMSRLFVPNIQQTPKDKQPRKQATKYPAAQATSTA
VIRPKAPEIKIRLGSVQQPSSDFNIAKLLTPKLAGGSASNLFKTIEDNSRAQQKLFRGDN
LEKVPHFQVRDIRDKSKAQGPLHQVRDVRKLIKGSGDSSDKGSVTPEQGLTGPKPRQLSA
AAGGSGSLSPMVITCQAVVNQREDSMDREPRESMGKGGGSRVLNSSSPEGTVLVHRASGR
LPVATIAPNKPEQGSYLPVLKIVSKASTQKTPEKLKEEEVKEEGKATKPARNALEKLTAA
VRSMEELYSFNRNEWKRKSDPLPMMMDSHVLSLIASEEREGVVVADGDHDKLSKRLGEVE
ERGTGNKAGVVLRGAPIERLQRRNSNPSAESVSARAAAFENLARERPRSLYIPPVHKDVE
RTQPLQPLPPLPSNRNVFTVSASSIQKTGGVAGKFPQGPSPESPSAAKGIKSQGLRSLKI
SPATRAPPDEVTNRKSGSNLEKSNSDCENYLTIPLKGSSAAGELLSRPGASREGPPNSSA
ATLCSLPPLSARSQVPSSSKGSQVSGTSRPAWRTKPDNPRETVAAPPGPQSPEHPPTTIY
HQPPLPFTLQGAQPQVLCFSPPSMPAPAPAASAPVPTDPFQQAQPQQTQRKMLLDVTTGQ
YYLVDTPVQPMTRRLFDPETGQYVDVPMTSQQQAVAPMSISVPPLALSPGAYGPTYMIYP
GFLPTVLPTNALQPTPIARAPRGSELSPMVAEPSSKEAAATFTEAPYFMASGQSPASSTS
SAPAATSQLLGAKAFAQLHGKPVISITSQPLGPRIIAPPSFDGTTMSFVVEHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z1D3	0.038	0.044	1.419E-7	1412	0.136	0.173	D3Z1D3.pdb.gz	CEFIP_MOUSE Cardiac-enriched FHL2-interacting protein OS=Mus musculus OX=10090 GN=CEFIP PE=1 SV=1
2	AFDB:M0RD54	0.043	0.050	2.090E-7	1422	0.138	0.174	M0RD54.pdb.gz	CEFIP_RAT Cardiac-enriched FHL2-interacting protein OS=Rattus norvegicus OX=10116 GN=CEFIP PE=3 SV=2
3	AFDB:Q711Q0	0.036	0.042	2.885E-7	1435	0.143	0.179	Q711Q0.pdb.gz	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2
4	AFDB:E7EW31	0.036	0.053	9.829E-7	1015	0.116	0.205	E7EW31.pdb.gz	PROB1_HUMAN Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2
5	AFDB:Q9VRM6	0.036	0.035	6.643E-4	1929	0.165	0.153	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
6	AFDB:F1LV37	0.034	0.033	2.930E-3	1818	0.148	0.146	F1LV37.pdb.gz	F1LV37_RAT Trinucleotide repeat containing adaptor 6B OS=Rattus norvegicus OX=10116 GN=Tnrc6b PE=1 SV=3
7	AFDB:Q9UGU0	0.031	0.030	7.711E-3	1960	0.163	0.149	Q9UGU0.pdb.gz	TCF20_HUMAN Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20 PE=1 SV=3
8	AFDB:Q9JL04	0.032	0.036	8.773E-3	1578	0.108	0.122	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
9	AFDB:A8DZ29	0.027	0.026	2.309E-2	1919	0.123	0.115	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
10	AFDB:B8A4S4	0.035	0.041	2.463E-2	1408	0.134	0.171	B8A4S4.pdb.gz	B8A4S4_DANRE Collagen, type XVII, alpha 1a OS=Danio rerio OX=7955 GN=si:ch211-281g13.3 PE=4 SV=1
11	PDB:7pntN	0.015	0.169	1.327	113	0.006	0.097	7pntN.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
12	PDB:7abzX	0.020	0.267	1.415	77	0.002	0.039	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
13	PDB:2wu9A	0.012	0.053	2.223	403	0.003	0.012	2wu9A.pdb.gz
14	PDB:7qi41	0.012	0.242	2.371	56	0.005	0.161	7qi41.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
15	PDB:5c0wJ	0.014	0.021	2.529	970	0.003	0.005	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
16	PDB:3j6bX	0.015	0.273	2.698	64	0.003	0.094	3j6bX.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:6xywAx	0.020	0.211	3.492	99	0.003	0.061	6xywAx.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
18	PDB:3j6bS	0.020	0.151	3.725	146	0.002	0.027	3j6bS.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
19	PDB:7l08V	0.019	0.088	3.725	206	0.007	0.058	7l08V.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
20	PDB:7p2eN	0.015	0.175	3.725	110	0.006	0.091	7p2eN.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1D3	4.79e-08	60.8	1412	0.018	0.023	CEFIP_MOUSE Cardiac-enriched FHL2-interacting protein OS=Mus musculus OX=10090 GN=CEFIP PE=1 SV=1
2	E7EW31	9.73e-08	59.7	1015	0.028	0.049	PROB1_HUMAN Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2
3	M0RD54	1.16e-07	59.7	1422	0.018	0.023	CEFIP_RAT Cardiac-enriched FHL2-interacting protein OS=Rattus norvegicus OX=10116 GN=CEFIP PE=3 SV=2
4	Q711Q0	9.33e-06	53.5	1435	0.019	0.024	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2
5	Q54VJ6	2.9	35.0	462	0.011	0.043	Q54VJ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280299 PE=4 SV=1
6	G5EFL0	8.7	33.5	845	0.013	0.028	GLD4_CAEEL Poly(A) RNA polymerase gld-4 OS=Caenorhabditis elegans OX=6239 GN=gld-4 PE=1 SV=1
7	Q9P1Y6	9.7	33.5	1649	0.013	0.015	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15232 DUF4585	5.7e-23	92.1	Domain of unknown function (DUF4585)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427555

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411932	0.567	Leiomodin-2
2	9606.ENSP00000386840	0.529	Xin actin-binding repeat-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.958	biological regulation
GO:0050789	0.895	regulation of biological process
GO:0009987	0.880	cellular process
GO:0050794	0.871	regulation of cellular process
GO:0032502	0.782	developmental process
GO:0048856	0.701	anatomical structure development
GO:0071840	0.609	cellular component organization or biogenesis
GO:0016043	0.602	cellular component organization
GO:0032501	0.594	multicellular organismal process
GO:0048518	0.576	positive regulation of biological process
GO:0006996	0.542	organelle organization
GO:0048522	0.369	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005737	0.990	cytoplasm
GO:0099512	0.974	supramolecular fiber
GO:0043232	0.968	intracellular non-membrane-bounded organelle
GO:0030016	0.963	myofibril
GO:0016020	0.936	membrane
GO:0030054	0.927	cell junction
GO:0043231	0.897	intracellular membrane-bounded organelle
GO:0005856	0.823	cytoskeleton
GO:0030017	0.756	sarcomere
GO:0005829	0.550	cytosol
GO:0005634	0.500	nucleus
GO:0005886	0.493	plasma membrane
GO:0120025	0.473	plasma membrane bounded cell projection
GO:0043005	0.458	neuron projection
GO:0098794	0.435	postsynapse
GO:0030424	0.392	axon
GO:0012505	0.344	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]