StarFunc result for job id E5RHQ5

User Input

>input (1161 residues)
MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPW
LHIIIAFPTSYKVVITLWIVYLWVSLLKTIFWSRNGHDGSTDVQQRAWRSNRRRQEGLRS
ICMHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTAR
KQKMFQRAQELRRRAEDYHKCKIPPSARKALCNWVRMAAAEHRHSSGLPYWPYLTAETLK
NRMGHQPPPPTQQHCITDNSLSLKTPLECLLTPLPPSADDNLKTPPECLLTPLPPSADDN
LKTPPECLLTPLPPSAPPSAPPSADDNLKTRAECLLHPLPPSADDNLKTPSERQLTPLPP
SAPPSADDNIKTTAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAEHLR
GPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQ
LTPLPPSAPPSADDNIKTPAEHLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKT
TAEHLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAEHLQFRFHPQRMIISR
DLPSVSSLPFHPQLHPQQMIISRYLLSICGFRFHRQRMIISRHLPSVSSLPFHPQLHPQQ
MIISRHLPSVCGGRFHPQPMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQ
PMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQPMIISRHLPSVSSLPFHP
QLHPQQMIISRHLPSVCGGRFHPQPMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCG
GRFHPQPMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGERLWVPLPPSADDNLKTP
SKRQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSKRQLTPLPPSAPPSADD
NIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSAD
DNLKTPSERQLTPLPPSAPTSADDNIKTPAERLRGPLPPSADDNLKTPPLATQEAEAEKP
RKPKRQRAAEMEPPPEPKRRRVGDVEPSRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKP
KRRRAADVEPSSPEPKRRRLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5RHQ5	1.000	1.000	0.000	1161	1.000	1.000	E5RHQ5.pdb.gz	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
2	AFDB:C9JG80	0.201	0.205	1.030E-94	1138	0.898	0.916	C9JG80.pdb.gz	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
3	AFDB:Q92617	0.163	0.179	2.545E-84	1050	0.847	0.936	Q92617.pdb.gz	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
4	AFDB:A6NJU9	0.127	0.129	5.295E-79	1138	0.864	0.881	A6NJU9.pdb.gz	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
5	AFDB:F8W0I5	0.137	0.154	5.517E-71	928	0.747	0.934	F8W0I5.pdb.gz	NPB12_HUMAN Nuclear pore complex-interacting protein family member B12 OS=Homo sapiens OX=9606 GN=NPIPB12 PE=3 SV=2
6	AFDB:P47179	0.084	0.084	1.310E-4	1161	0.073	0.073	P47179.pdb.gz	DAN4_YEAST Cell wall protein DAN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAN4 PE=2 SV=1
7	AFDB:Q9C105	0.078	0.075	3.791E-3	1236	0.088	0.083	Q9C105.pdb.gz	YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1E7.04c PE=3 SV=1
8	AFDB:Q54G14	0.044	0.046	1.339E-2	1081	0.080	0.086	Q54G14.pdb.gz	Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0290685 PE=2 SV=2
9	AFDB:Q9C0J8	0.038	0.034	4.956E-2	1336	0.146	0.126	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
10	AFDB:Q86V48	0.039	0.042	6.560E-2	1076	0.129	0.139	Q86V48.pdb.gz	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
11	PDB:3d8vA	0.064	0.101	1.403	478	0.019	0.046	3d8vA.pdb.gz	Structure and function of GlmU from Mycobacterium tuberculosis.
12	PDB:2oi6B	0.065	0.119	3.923	452	0.015	0.038	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.
13	PDB:7suk6	0.037	0.114	6.875	277	0.028	0.119	7suk6.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJU9	0.0	1213	1138	0.594	0.606	NPB13_HUMAN Nuclear pore complex-interacting protein family member B13 OS=Homo sapiens OX=9606 GN=NPIPB13 PE=3 SV=4
2	A8MRT5	0.0	1835	1133	0.914	0.936	NPIB5_HUMAN Nuclear pore complex-interacting protein family member B5 OS=Homo sapiens OX=9606 GN=NPIPB5 PE=2 SV=3
3	C9JG80	0.0	1746	1138	0.898	0.916	NPIB4_HUMAN Nuclear pore complex-interacting protein family member B4 OS=Homo sapiens OX=9606 GN=NPIPB4 PE=3 SV=2
4	E5RHQ5	0.0	2290	1161	1.000	1.000	NPB11_HUMAN Nuclear pore complex-interacting protein family member B11 OS=Homo sapiens OX=9606 GN=NPIPB11 PE=3 SV=1
5	E9PKP1	0.0	953	595	0.488	0.953	E9PKP1_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
6	F5H4N5	0.0	701	358	0.297	0.964	F5H4N5_HUMAN Nuclear pore complex interacting protein family member B3 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB3 PE=3 SV=1
7	F6SDX0	0.0	953	595	0.488	0.953	F6SDX0_HUMAN Nuclear pore complex interacting protein family member B5 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB5 PE=3 SV=1
8	F8W0I5	0.0	594	928	0.308	0.386	NPB12_HUMAN Nuclear pore complex-interacting protein family member B12 OS=Homo sapiens OX=9606 GN=NPIPB12 PE=3 SV=2
9	Q92617	0.0	1646	1050	0.847	0.936	NPIB3_HUMAN Nuclear pore complex-interacting protein family member B3 OS=Homo sapiens OX=9606 GN=NPIPB3 PE=1 SV=5
10	E9PQR5	1.76e-171	514	432	0.248	0.667	NPIB8_HUMAN Nuclear pore complex-interacting protein family member B8 OS=Homo sapiens OX=9606 GN=NPIPB8 PE=3 SV=1
11	E9PJ23	1.82e-169	508	425	0.235	0.642	NPIB6_HUMAN Nuclear pore complex-interacting protein family member B6 OS=Homo sapiens OX=9606 GN=NPIPB6 PE=3 SV=1
12	E9PNV8	7.78e-158	476	369	0.229	0.721	E9PNV8_HUMAN Nuclear pore complex interacting protein family member A3 OS=Homo sapiens OX=9606 GN=NPIPA3 PE=3 SV=1
13	E9PIF3	2.87e-148	451	369	0.227	0.713	NPIA2_HUMAN Nuclear pore complex-interacting protein family member A2 OS=Homo sapiens OX=9606 GN=NPIPA2 PE=3 SV=1
14	A6NJ64	1.03e-146	448	397	0.212	0.620	NPIB2_HUMAN Putative nuclear pore complex-interacting protein family member B2 OS=Homo sapiens OX=9606 GN=NPIPB2 PE=5 SV=4
15	A6NHN6	8.15e-141	434	443	0.211	0.553	NPB15_HUMAN Nuclear pore complex-interacting protein family member B15 OS=Homo sapiens OX=9606 GN=NPIPB15 PE=3 SV=3
16	F8W1W9	1.49e-139	431	429	0.214	0.578	NPIB9_HUMAN Nuclear pore complex-interacting protein family member B9 OS=Homo sapiens OX=9606 GN=NPIPB9 PE=3 SV=1
17	A0A1B0GW90	8.97e-139	426	370	0.196	0.614	A0A1B0GW90_HUMAN Uncharacterized protein (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
18	I3L0I5	4.79e-138	426	421	0.212	0.584	I3L0I5_HUMAN Nuclear pore complex interacting protein family member B7 (Fragment) OS=Homo sapiens OX=9606 GN=NPIPB7 PE=3 SV=2
19	E9PS57	7.79e-138	425	407	0.202	0.575	E9PS57_HUMAN Nuclear pore complex interacting protein family member B6 OS=Homo sapiens OX=9606 GN=NPIPB6 PE=1 SV=1
20	O75200	2.50e-137	424	414	0.212	0.594	NPIB7_HUMAN Nuclear pore complex-interacting protein family member B7 OS=Homo sapiens OX=9606 GN=NPIPB7 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07337 CagY_M	68	14.5	DC-EC Repeat
2	PF12178 INCENP_N	1	20.7	Chromosome passenger complex (CPC) protein INCENP N terminal
3	PF06409 NPIP	6.5e-154	522.4	Nuclear pore complex interacting protein (NPIP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430853

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357575	0.635	Cilia- and flagella-associated protein 46
2	9606.ENSP00000463957	0.603	Neuroblastoma breakpoint family member 10
3	9606.ENSP00000477979	0.603	Neuroblastoma breakpoint family member 20
4	9606.ENSP00000281589	0.563	Polyadenylate-binding protein 3
5	9606.ENSP00000402394	0.517	Carbohydrate sulfotransferase 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.408	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.705	biological regulation
GO:0009987	0.698	cellular process
GO:0050789	0.555	regulation of biological process
GO:0050794	0.411	regulation of cellular process
GO:0048518	0.392	positive regulation of biological process
GO:0048522	0.372	positive regulation of cellular process
GO:0008152	0.347	metabolic process
GO:0071704	0.317	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.480	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]