StarFunc result for job id E7EW31

User Input

>input (1015 residues)
MLTALAPPALPGIPRQLPTAPARRQDSSGSSGSYYTAPGSPEPPDVGPDAKGPANWPWVA
PGRGAGAQPRLSVSAQNSRQRHGPGSGFPRGPGSGPRPPQPQLRTLPSGEMEVIFGVGPL
FGCSGADDREAQQQFTEPAFISPLPPGPASPAAVPRQSQVPDGGSRWATYLELRPRGPSP
AAPAQFECVEVALEEGAAPARPRTVPKRQIELRPRPQSPPRAAGAPRPRLLLRTGSLDES
LGPLQAAAGFVQTALARKLSPEAPAPSSATFGSTGRSEPETRETARSTHVVLEKAKSRPL
RVRDNSAPAKAPRPWPSLRERAIRRDKPAPGTEPLGPVSSSIFLQSEEKIQEARKTRFPR
EAPDRTVQRARSPPFECRIPSEVPSRAVRPRSPSPPRQTPNGAVRGPRCPSPQNLSPWDR
TTRRVSSPLFPEASSEWENQNPAVEETVSRRSPSPPILSQWNQCVAGERSPSLEAPSLWE
IPHSAVADAVEPRSSPSPPAFFPWEAPDRPIGTWGPSPQETWDPMGPGSSIAFTQEAQNG
LTQEELAPPTPSAPGTPEPTEMQSPSTREISDLAFGGSQQSPEVAAPEPPGSHPVGTLDA
DKCPEVLGPGEAASGRPRMAIPRPRDVRKLVKTTYAPGFPAGAQGSGLPAPPADPCGEEG
GESKTQEPPALGPPAPAHYTSVFIKDFLPVVPHPYEPPEPSFDTVARDASQPNGVLRRRA
ENSTAKPFKRTEIRLPGALALGRRPEVTSRVRARGPGGENRDVEAQRLVPDGDGRTSPLG
GARSSSQRSPVGPAGVRSPRPGSPQMQASPSPGIAPKPKTPPTAPEPAAAVQAPLPREPL
ALAGRTAPAQPRAASAPPTDRSPQSPSQGARRQPGAAPLGKVLVDPESGRYYFVEAPRQP
RLRVLFDPESGQYVEVLLPPSSPGPPHRVYTPLALGLGLYPPAYGPIPSLSLPPSPGPQA
LGSPQLPWVSEAGPLDGTYYLPVSGTPNPAPPLLLCAPPSSSGPTQPGKGSLFPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EW31	0.999	0.999	0.000	1015	1.000	1.000	E7EW31.pdb.gz	PROB1_HUMAN Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2
2	AFDB:Q711Q0	0.052	0.041	1.350E-5	1435	0.233	0.164	Q711Q0.pdb.gz	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2
3	AFDB:M0RD54	0.059	0.046	9.749E-4	1422	0.208	0.148	M0RD54.pdb.gz	CEFIP_RAT Cardiac-enriched FHL2-interacting protein OS=Rattus norvegicus OX=10116 GN=CEFIP PE=3 SV=2
4	AFDB:D3Z1D3	0.049	0.039	1.430E-3	1412	0.192	0.138	D3Z1D3.pdb.gz	CEFIP_MOUSE Cardiac-enriched FHL2-interacting protein OS=Mus musculus OX=10090 GN=CEFIP PE=1 SV=1
5	AFDB:O70305	0.038	0.036	8.553E-3	1285	0.194	0.153	O70305.pdb.gz	ATX2_MOUSE Ataxin-2 OS=Mus musculus OX=10090 GN=Atxn2 PE=1 SV=1
6	AFDB:Q2Q0I9	0.048	0.030	1.104E-2	1779	0.188	0.107	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
7	AFDB:E9Q4F7	0.042	0.021	2.229E-2	2643	0.181	0.070	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
8	AFDB:A0A1Y7VMP7	0.042	0.032	5.811E-2	1443	0.114	0.080	A0A1Y7VMP7.pdb.gz	A0A1Y7VMP7_MOUSE MutL homolog 3 OS=Mus musculus OX=10090 GN=Mlh3 PE=1 SV=1
9	AFDB:Q9JL04	0.048	0.038	9.087E-2	1578	0.208	0.134	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
10	AFDB:A7UMX5	0.042	0.043	1.101E-1	996	0.150	0.153	A7UMX5.pdb.gz	A7UMX5_MELGA Synaptopodin 2 variant OS=Meleagris gallopavo OX=9103 PE=2 SV=1
11	PDB:7abzX	0.036	0.329	2.629	77	0.003	0.039	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
12	PDB:3j6bX	0.028	0.197	3.394	64	0.011	0.172	3j6bX.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
13	PDB:7eebJ	0.022	0.104	3.857	161	0.007	0.043	7eebJ.pdb.gz	Structure of a mammalian sperm cation channel complex.
14	PDB:5c0wJ	0.021	0.022	4.111	970	0.008	0.008	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
15	PDB:2wu9A	0.017	0.042	4.382	403	0.006	0.015	2wu9A.pdb.gz
16	PDB:7odxA	0.019	0.052	4.382	350	0.004	0.011	7odxA.pdb.gz	Characterization of a triad of genes in cyanophage S-2L sufficient to replace adenine by 2-aminoadenine in bacterial DNA.
17	PDB:3b70A	0.018	0.048	4.671	357	0.006	0.017	3b70A.pdb.gz	Crystal structure and biochemical studies of the trans-acting polyketide enoyl reductase LovC from lovastatin biosynthesis.
18	PDB:7odrX	0.025	0.086	4.979	244	0.011	0.045	7odrX.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
19	PDB:7okxO	0.024	0.172	4.979	106	0.009	0.085	7okxO.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
20	PDB:7qi41	0.019	0.287	5.658	56	0.006	0.107	7qi41.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EW31	0.0	1942	1015	1.000	1.000	PROB1_HUMAN Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2
2	M0RD54	7.24e-07	55.8	1422	0.032	0.023	CEFIP_RAT Cardiac-enriched FHL2-interacting protein OS=Rattus norvegicus OX=10116 GN=CEFIP PE=3 SV=2
3	D3Z1D3	1.32e-06	55.1	1412	0.033	0.023	CEFIP_MOUSE Cardiac-enriched FHL2-interacting protein OS=Mus musculus OX=10090 GN=CEFIP PE=1 SV=1
4	Q711Q0	5.39e-06	53.1	1435	0.027	0.019	CEFIP_HUMAN Cardiac-enriched FHL2-interacting protein OS=Homo sapiens OX=9606 GN=CEFIP PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15232 DUF4585	3.9e-19	79.8	Domain of unknown function (DUF4585)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414920	0.546	Spermatogenesis-associated protein 24
2	9606.ENSP00000367356	0.503	Protein FAM171A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.557	cellular process
GO:0048518	0.552	positive regulation of biological process
GO:0048522	0.310	positive regulation of cellular process
GO:0019222	0.301	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.707	cytoplasm
GO:0043232	0.389	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]