StarFunc result for job id E9PAV3

User Input

>input (2078 residues)
MPGEATETVPATEQELPQPQAETAVLPMSSALSVTAALGQPGPTLPPPCSPAPQQCPLSA
ANQASPFPSPSTIASTPLEVPFPQSSSGTALPLGTAPEAPTFLPNLIGPPISPAALALAS
PMIAPTLKGTPSSSAPLALVALAPHSVQKSSAFPPNLLTSPPSVAVAESGSVITLSAPIA
PSEPKTNLNKVPSEVVPNPKGTPSPPCIVSTVPYHCVTPMASIQSGVASLPQTTPTTTLA
IASPQVKDTTISSVLISPQNPGSLSLKGPVSPPAALSLSTQSLPVVTSSQKTAGPNTPPD
FPISLGSHLAPLHQSSFGSVQLLGQTGPSALSDPTVKTISVDHSSTGASYPSQRSVIPPL
PSRNEVVPATVAAFPVVAPSVDKGPSTISSITCSPSGSLNVATSFSLSPTTSLILKSSPN
ATYHYPLVAQMPVSSVGTTPLVVTNPCTIAAAPTTTFEVATCVSPPMSSGPISNIEPTSP
AALVMAPVAPKEPSTQVATTLRIPVSPPLPDPEDLKNLPSSVLVKFPTQKDLQTVPASLE
GAPFSPAQAGLTTKKDPTVLPLVQAAPKNSPSFQSTSSSPEIPLSPEATLAKKSLGEPLP
IGKPASSMTSPLGVNSSASVIKTDSYAGPDSAGPLLKSSLITPTVAAFPLESADPAGVAP
TTAKGTSTYTTTASPFLEGTVSLAPKNHPVKEGTLTTLPLVPTASENCPVAPSPQNTCAP
LATLVLAPEIPKSVPSPSLPPAGTPPGTKKVDGISHTSALAPVASSPKECPTEDSGASAT
ASSKGTLTYLADSPSPLGVSVSPQTKRPPTKKGSAGPDTPIGNLSSPVSPVEASFLPENS
LSFQGSKDSPATTHSPTPPSPKGAPTPSAVTPLSPKGVTLPPKETPTPSVVNLPFPKEGP
ATPAPKQAPALSMTSSSPKKARATPAPKGIPASPSPKGAPTPPAATPPSPKGGPATPSPK
WAPTPPAATPPSPKGGPATPSPKGAPTPPAATPPSPKGGPATPSPKGAPTPPAVTPPSPK
GSPAATPFPKGASTPPAATPPSPKGSPAATPLPKGAPTTPAATLPSPKGGPATPSLKGAP
TPPAATPPSPKGGPATPSPKGAPMPPAATPPSPKGGLATPPHKGAPTTPAATPPSPKGGL
ATPPPKGAPTTPAATPPSPKGGLATPPPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAA
TPPSPKGGLATPSPKGAPTTPAATPPSPKGGLATPSPKGAPTTPAATPPSPKGGPATPPP
KGAPTPPAATPPSLKGGLATPPHKGAPNPAVVTPPSPKGGPATSPPKGAPTPPAATPPSP
KGSPGTPPPKGAPTPPAVTPPSPKGTPTLPATTPSSKGGPTTPSSKEGPTPPAATPSHKG
GPAMTPPSPKRGPAIPSPKGDPTSPAVIPLSPKKAPATPVTREGAATPSKGDLTPPAVTP
VSLKKAPATSAPKGGPATPSSKGDPTLPAVTPPSPKEPPAPKQVATSSSPKKAPATPAPM
GAPTLPAVIPSSPKEVPATPSSRRDPIAPTATLLSKKTPATLAPKEALIPPAMTVPSPKK
TPAIPTPKEAPATPSSKEASSPPAVTPSTYKGAPSPKELLIPPAVTSPSPKEAPTPPAVT
PPSPEKGPATPAPKGTPTSPPVTPSSLKDSPTSPASVTCKMGATVPQASKGLPAKKGPTA
LKEVLVAPAPESTPIITAPTRKGPQTKKSSATSPPICPDPSAKNGSKGPLSTVAPAPLLP
VQKDSSKTAKGKDASHSPKGPLAPPESKASTPLTAAAFEKVLPKPESASVSAAPSPPVSL
PLAPSPVPTLPPKQQFLPSSPGLVLESPSKPLAPADEDELLPLIPPEPISGGVPFQSVLV
NMPTPKSAGIPVPTPSAKQPVTKNNKGSGTESDSDESVPELEEQDSTQATTQQAQLAAAA
EIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPAS
DTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVE
VKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70670	0.119	0.114	8.090E-68	2187	0.510	0.485	P70670.pdb.gz	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
2	AFDB:O15069	0.073	0.092	1.396E-23	1562	0.218	0.290	O15069.pdb.gz	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
3	PDB:7qwrt	0.032	0.892	6.633E-9	67	0.032	1.000	7qwrt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
4	PDB:7qwqt	0.022	0.854	7.737E-4	47	0.023	1.000	7qwqt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
5	AFDB:Q9VQM0	0.023	0.023	1.684E-2	2162	0.143	0.138	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
6	PDB:6c95D	0.019	0.393	1.241E-1	95	0.007	0.158	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
7	AFDB:Q9W2S5	0.030	0.029	1.315E-1	2139	0.142	0.138	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
8	PDB:6j6qF	0.015	0.116	1.784E-1	161	0.007	0.093	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
9	AFDB:Q2VIS4	0.025	0.027	2.008E-1	2362	0.158	0.139	Q2VIS4.pdb.gz	FILA2_MOUSE Filaggrin-2 OS=Mus musculus OX=10090 GN=Flg2 PE=1 SV=2
10	AFDB:O42854	0.028	0.033	2.408E-1	1611	0.120	0.155	O42854.pdb.gz	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
11	AFDB:Q68DN1	0.024	0.024	2.558E-1	1984	0.139	0.146	Q68DN1.pdb.gz	CB016_HUMAN Uncharacterized protein C2orf16 OS=Homo sapiens OX=9606 GN=C2orf16 PE=2 SV=3
12	AFDB:Q9BTC0	0.026	0.025	3.257E-1	2240	0.181	0.168	Q9BTC0.pdb.gz	DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5
13	AFDB:Q9NZ56	0.025	0.026	3.257E-1	1722	0.128	0.154	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
14	AFDB:Q9VUE8	0.030	0.026	3.257E-1	2637	0.166	0.131	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
15	PDB:5j0nF	0.021	0.060	3.469E-1	356	0.003	0.020	5j0nF.pdb.gz	Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
16	PDB:1n3gA	0.023	0.193	3.685E-1	113	0.006	0.115	1n3gA.pdb.gz
17	PDB:1jkfA	0.023	0.078	4.159E-1	466	0.006	0.026	1jkfA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase
18	PDB:5yzgY	0.016	0.080	4.159E-1	204	0.005	0.054	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:4gwqG	0.026	0.163	4.418E-1	170	0.008	0.100	4gwqG.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
20	PDB:7cunI	0.015	0.037	6.745E-1	624	0.003	0.010	7cunI.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70670	0.0	1073	2187	0.518	0.492	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
2	Q13765	8.70e-109	347	215	0.092	0.893	NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1
3	Q60817	8.70e-109	347	215	0.091	0.884	NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus OX=10090 GN=Naca PE=1 SV=1
4	Q8JIU7	3.22e-106	340	215	0.092	0.888	NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio OX=7955 GN=naca PE=1 SV=1
5	O15069	1.64e-64	246	1562	0.064	0.085	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
6	Q94518	6.94e-60	207	217	0.052	0.498	NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=Nacalpha PE=1 SV=2
7	Q86S66	7.16e-55	192	195	0.053	0.569	NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans OX=6239 GN=icd-2 PE=1 SV=2
8	Q94JX9	2.63e-48	174	217	0.044	0.424	NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
9	Q9LHG9	4.21e-45	164	203	0.048	0.488	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
10	Q9SZY1	2.53e-44	162	212	0.045	0.443	NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
11	Q6ICZ8	3.88e-43	159	204	0.046	0.466	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
12	Q8LGC6	1.40e-42	157	209	0.042	0.421	NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g33040 PE=2 SV=2
13	P87147	1.87e-35	135	173	0.036	0.428	NACA_SCHPO Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=egd2 PE=1 SV=1
14	Q9VPV7	1.45e-29	124	347	0.041	0.248	Q9VPV7_DROME GH09281p OS=Drosophila melanogaster OX=7227 GN=gNacalpha PE=2 SV=2
15	Q6FJD5	3.13e-27	112	165	0.029	0.370	NACA_CANGA Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EGD2 PE=3 SV=1
16	Q38EE8	2.36e-24	104	188	0.029	0.324	Q38EE8_TRYB2 Nascent polypeptide associated complex subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0120 PE=4 SV=1
17	Q5ANP2	6.53e-24	102	178	0.032	0.371	NACA_CANAL Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EGD2 PE=3 SV=1
18	P38879	6.89e-20	91.3	174	0.028	0.339	NACA_YEAST Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGD2 PE=1 SV=3
19	O77375	3.52e-08	61.6	2457	0.026	0.022	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1
20	P08775	2.79e-05	52.0	1970	0.026	0.027	RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19026 HYPK_UBA	3.1e-06	37.8	HYPK UBA domain
2	PF01849 NAC	3e-18	76.9	NAC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000020576

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000019461	0.947	Basic transcription factor 3
2	9593.ENSGGOP00000025179	0.947	Uncharacterized protein
3	9593.ENSGGOP00000002077	0.883	Nascent polypeptide-associated complex alpha subunit 2
4	9593.ENSGGOP00000010413	0.859	Transcription factor BTF3
5	9593.ENSGGOP00000022825	0.859	Basic transcription factor 3-like 4
6	9593.ENSGGOP00000024288	0.859	Transcription factor BTF3
7	9593.ENSGGOP00000025699	0.803	Belongs to the protein kinase superfamily.
8	9593.ENSGGOP00000024801	0.787	SET and MYND domain containing 1
9	9593.ENSGGOP00000022421	0.765	Bardet-Biedl syndrome 10
10	9593.ENSGGOP00000021047	0.758	Ribosomal protein L35a
11	9593.ENSGGOP00000021166	0.719	Fibrillarin
12	9593.ENSGGOP00000003636	0.708	Ribosomal protein L4
13	9593.ENSGGOP00000025944	0.708	Uncharacterized protein
14	9593.ENSGGOP00000011321	0.700	Ribosomal protein L24
15	9593.ENSGGOP00000007981	0.694	Ribosomal protein L8
16	9593.ENSGGOP00000004034	0.688	Ribosomal protein L35
17	9593.ENSGGOP00000016936	0.688	Ribosomal protein L35
18	9593.ENSGGOP00000000385	0.686	Integrin-linked kinase
19	9593.ENSGGOP00000010519	0.681	Ribosomal protein, large, P2
20	9593.ENSGGOP00000015361	0.673	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140296	0.991	general transcription initiation factor binding
GO:0017025	0.978	TBP-class protein binding
GO:0140110	0.972	transcription regulator activity
GO:0003713	0.931	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048870	0.945	cell motility
GO:0016477	0.380	cell migration
GO:0014812	0.351	muscle cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005634	0.986	nucleus
GO:0043233	0.500	organelle lumen
GO:0070013	0.480	intracellular organelle lumen
GO:0043232	0.377	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]