StarFunc result for job id E9PRG8

User Input

>input (123 residues)
MGAPGGKINRPRTELKKKLFKRRRVLNRERRLRHRVVGAVIDQGLITRHHLKKRASSARA
NITLSGKKRRKLLQQIRLAQKEKTAMEVEAPSKPARTSEPQLKRQKKTKAPQDVEMKDLE
DES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NPI5	0.200	0.111	7.209E-1	230	0.089	0.048	Q9NPI5.pdb.gz	NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens OX=9606 GN=NMRK2 PE=1 SV=1
2	AFDB:Q9SN78	0.212	0.102	7.209E-1	333	0.179	0.066	Q9SN78.pdb.gz	MYB94_ARATH Transcription factor MYB94 OS=Arabidopsis thaliana OX=3702 GN=MYB94 PE=1 SV=1
3	AFDB:A0A1D8PCF5	0.186	0.048	2.071	738	0.106	0.018	A0A1D8PCF5.pdb.gz	A0A1D8PCF5_CANAL Zcf17p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ZCF17 PE=4 SV=1
4	AFDB:Q9UIW0	0.172	0.113	2.071	290	0.220	0.093	Q9UIW0.pdb.gz	VAX2_HUMAN Ventral anterior homeobox 2 OS=Homo sapiens OX=9606 GN=VAX2 PE=1 SV=1
5	AFDB:E7EC82	0.154	0.089	2.222	244	0.228	0.115	E7EC82.pdb.gz	E7EC82_CHICK B-cell lymophoma 10 protein OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:Q24407	0.211	0.237	2.222	106	0.171	0.198	Q24407.pdb.gz	ATP5J_DROME ATP synthase-coupling factor 6, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynCF6 PE=3 SV=1
7	AFDB:Q966M4	0.206	0.063	2.745	446	0.106	0.029	Q966M4.pdb.gz	Q966M4_CAEEL Unconventional prefoldin RPB5 interactor OS=Caenorhabditis elegans OX=6239 GN=uri-1 PE=1 SV=1
8	AFDB:Q9LV52	0.195	0.076	2.745	330	0.163	0.061	Q9LV52.pdb.gz	HSFC1_ARATH Heat stress transcription factor C-1 OS=Arabidopsis thaliana OX=3702 GN=HSFC1 PE=1 SV=1
9	AFDB:Q01608	0.146	0.047	2.945	465	0.154	0.041	Q01608.pdb.gz	SPE4_CAEEL Presenilin spe-4 OS=Caenorhabditis elegans OX=6239 GN=spe-4 PE=1 SV=1
10	AFDB:Q9W236	0.214	0.149	2.945	212	0.154	0.090	Q9W236.pdb.gz	Q9W236_DROME Vacuolar protein sorting 20, isoform A OS=Drosophila melanogaster OX=7227 GN=Vps20 PE=1 SV=1
11	PDB:4v6wCG	0.137	0.086	4.406	241	0.171	0.087	4v6wCG.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	PDB:6govN	0.190	0.211	5.442	110	0.106	0.118	6govN.pdb.gz	Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
13	PDB:7p2eG	0.138	0.063	5.839	330	0.146	0.055	7p2eG.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
14	PDB:6ke6A8	0.166	0.056	8.300	548	0.163	0.036	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
15	PDB:6b1uA	0.205	0.074	8.906	442	0.065	0.018	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
16	PDB:7mq8SB	0.192	0.066	8.906	440	0.114	0.032	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:1rquA	0.142	0.145	9.555	120	0.089	0.092	1rquA.pdb.gz
18	PDB:5oxpA	0.219	0.063	9.555	462	0.065	0.017	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8I2F7	0.40	32.0	326	0.163	0.061	Q8I2F7_PLAF7 Ring-exported protein 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0936300 PE=4 SV=1
2	O13652	0.64	31.6	840	0.130	0.019	SFI1_SCHPO Protein sfi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfi1 PE=3 SV=3
3	Q8GTR4	4.1	29.3	965	0.106	0.013	PULA1_ARATH Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
4	F4IIC2	6.8	28.5	762	0.098	0.016	F4IIC2_ARATH F-box/LRR protein OS=Arabidopsis thaliana OX=3702 GN=RAD7A PE=1 SV=1
5	Q9LXZ4	7.8	28.1	348	0.122	0.043	Q9LXZ4_ARATH GroES-like zinc-binding alcohol dehydrogenase family protein OS=Arabidopsis thaliana OX=3702 GN=T5P19_110 PE=1 SV=1
6	Q7Z3E1	8.1	28.5	657	0.138	0.026	PARPT_HUMAN Protein mono-ADP-ribosyltransferase TIPARP OS=Homo sapiens OX=9606 GN=TIPARP PE=1 SV=1
7	Q383P4	9.8	28.1	339	0.195	0.071	Q383P4_TRYB2 IQ calmodulin-binding motif containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2120 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17719 DUF5564	3.2e-49	176.4	Family of unknown function (DUF5564)
2	PF09924 LPG_synthase_C	1.9e+02	12.5	Phosphatidylglycerol lysyltransferase, C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000432523

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318195	0.596	Nucleolin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003676	0.990	nucleic acid binding
GO:0003677	0.685	DNA binding
GO:0043565	0.352	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0050789	0.980	regulation of biological process
GO:0050794	0.944	regulation of cellular process
GO:0019222	0.927	regulation of metabolic process
GO:0009987	0.921	cellular process
GO:0060255	0.888	regulation of macromolecule metabolic process
GO:0080090	0.757	regulation of primary metabolic process
GO:0051171	0.750	regulation of nitrogen compound metabolic process
GO:0048519	0.749	negative regulation of biological process
GO:0048518	0.746	positive regulation of biological process
GO:0032501	0.719	multicellular organismal process
GO:0031323	0.708	regulation of cellular metabolic process
GO:0010468	0.656	regulation of gene expression
GO:0010605	0.598	negative regulation of macromolecule metabolic process
GO:0019219	0.568	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.552	negative regulation of cellular process
GO:0050896	0.444	response to stimulus
GO:0048856	0.421	anatomical structure development
GO:0048522	0.420	positive regulation of cellular process
GO:0009893	0.377	positive regulation of metabolic process
GO:0051173	0.369	positive regulation of nitrogen compound metabolic process
GO:0010604	0.364	positive regulation of macromolecule metabolic process
GO:0051716	0.353	cellular response to stimulus
GO:0009889	0.341	regulation of biosynthetic process
GO:0051252	0.341	regulation of RNA metabolic process
GO:0051172	0.339	negative regulation of nitrogen compound metabolic process
GO:0031324	0.339	negative regulation of cellular metabolic process
GO:0051246	0.336	regulation of protein metabolic process
GO:0071704	0.317	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	0.997	nucleolus
GO:0005654	0.960	nucleoplasm
GO:0016020	0.723	membrane
GO:0071944	0.537	cell periphery
GO:0005737	0.427	cytoplasm
GO:0032991	0.392	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]