StarFunc result for job id F2Z333

User Input

>input (226 residues)
MRAPPLLLLLAACAPPPCAAAAPTPPGWEPTPDAPWCPYKVLPEGPEAGGGRLCFRSPAR
GFRCQAPGCVLHAPAGRSLRASVLRNRSVLLQWRLAPAAARRVRAFALNCSWRGAYTRFP
CERVLLGASCRDYLLPDVHDSVLYRLCLQPLPLRAGPAAAAPETPEPAECVEFTAEPAGM
QDIVVAMTAVGGSICVMLVVICLLVAYITENLMRPALARPGLRRHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BTN0	0.359	0.141	2.591E-6	628	0.168	0.061	Q9BTN0.pdb.gz	LRFN3_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRFN3 PE=2 SV=1
2	AFDB:B8A507	0.314	0.119	3.209E-6	649	0.155	0.054	B8A507.pdb.gz	B8A507_DANRE Fibronectin leucine-rich transmembrane 3 OS=Danio rerio OX=7955 GN=fb93g11 PE=1 SV=1
3	AFDB:O43155	0.362	0.133	3.572E-6	660	0.181	0.062	O43155.pdb.gz	FLRT2_HUMAN Leucine-rich repeat transmembrane protein FLRT2 OS=Homo sapiens OX=9606 GN=FLRT2 PE=1 SV=1
4	AFDB:Q9P244	0.326	0.108	3.572E-6	771	0.190	0.056	Q9P244.pdb.gz	LRFN1_HUMAN Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRFN1 PE=1 SV=2
5	AFDB:B1H234	0.326	0.123	8.404E-6	649	0.168	0.059	B1H234.pdb.gz	FLRT3_RAT Leucine-rich repeat transmembrane protein FLRT3 OS=Rattus norvegicus OX=10116 GN=Flrt3 PE=1 SV=1
6	AFDB:F1QF54	0.337	0.115	8.404E-6	715	0.168	0.053	F1QF54.pdb.gz	F1QF54_DANRE Fibronectin leucine-rich transmembrane protein 1b OS=Danio rerio OX=7955 GN=flrt1b PE=1 SV=2
7	AFDB:D4A1J9	0.282	0.100	1.158E-5	719	0.146	0.046	D4A1J9.pdb.gz	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
8	AFDB:Q6RKD8	0.315	0.120	1.597E-5	646	0.204	0.071	Q6RKD8.pdb.gz	FLRT1_MOUSE Leucine-rich repeat transmembrane protein FLRT1 OS=Mus musculus OX=10090 GN=Flrt1 PE=1 SV=2
9	AFDB:Q6EMK4	0.332	0.122	2.201E-5	673	0.177	0.059	Q6EMK4.pdb.gz	VASN_HUMAN Vasorin OS=Homo sapiens OX=9606 GN=VASN PE=1 SV=1
10	AFDB:D4ABX8	0.357	0.138	2.449E-5	636	0.195	0.069	D4ABX8.pdb.gz	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1
11	PDB:7u7nC	0.229	0.255	3.623E-2	200	0.088	0.100	7u7nC.pdb.gz
12	PDB:7bw8C	0.271	0.418	4.487E-2	138	0.062	0.101	7bw8C.pdb.gz
13	PDB:6xi2A	0.218	0.106	4.994E-2	528	0.053	0.023	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.
14	PDB:3csbA	0.261	0.134	6.525E-2	464	0.058	0.028	3csbA.pdb.gz	A Dominant Conformational Role for Amino Acid Diversity in Minimalist Protein-Protein Interfaces
15	PDB:4b0mM	0.204	0.214	7.661E-2	212	0.053	0.057	4b0mM.pdb.gz
16	PDB:1xo8A	0.206	0.279	8.081E-2	151	0.049	0.073	1xo8A.pdb.gz
17	PDB:3fxiC	0.256	0.358	1.056E-1	140	0.080	0.129	3fxiC.pdb.gz
18	PDB:4n2iA	0.129	0.063	1.114E-1	662	0.058	0.020	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
19	PDB:5hp5A	0.164	0.070	1.175E-1	669	0.075	0.025	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
20	PDB:8eyyA	0.270	0.090	1.175E-1	775	0.058	0.017	8eyyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02388	0.21	35.0	2944	0.106	0.008	CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1 PE=1 SV=2
2	F1SKM1	3.4	31.2	2938	0.102	0.008	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
3	Q9Y6Q9	5.4	30.8	1424	0.088	0.014	NCOA3_HUMAN Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1
4	O13936	6.9	30.4	990	0.071	0.016	SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spt5 PE=1 SV=1
5	A0A0B4K718	8.8	30.0	4100	0.058	0.003	A0A0B4K718_DROME Short stop, isoform AB OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
6	A0A0B4K788	8.8	30.0	5462	0.058	0.002	A0A0B4K788_DROME Short stop, isoform AC OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	A0A0B4K7P8	8.8	30.0	5394	0.058	0.002	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	A0A0B4K7Y9	8.8	30.0	5408	0.058	0.002	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	A0A0B4K867	8.8	30.0	5463	0.058	0.002	A0A0B4K867_DROME Short stop, isoform Y OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	A0A0B4K869	8.8	30.0	5434	0.058	0.002	A0A0B4K869_DROME Short stop, isoform AD OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	A1Z9I8	8.8	30.0	5385	0.058	0.002	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	A1Z9I9	8.8	30.0	5390	0.058	0.002	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	A1Z9J0	8.8	30.0	5201	0.058	0.002	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	A1Z9J1	8.8	30.0	5501	0.058	0.002	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	A1Z9J2	8.8	30.0	5160	0.058	0.003	A1Z9J2_DROME Short stop, isoform C OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	B7YZG2	8.8	30.0	5370	0.058	0.002	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	B7YZG3	8.8	30.0	5375	0.058	0.002	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	B7YZG4	8.8	30.0	5368	0.058	0.002	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	B7YZG5	8.8	30.0	5486	0.058	0.002	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	B7YZG6	8.8	30.0	5479	0.058	0.002	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17742 DUF5579	7.8e-109	373.5	Family of unknown function (DUF5579)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000028402

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000017319	0.528	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.447	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0050789	0.624	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0043226	0.979	organelle
GO:0043227	0.952	membrane-bounded organelle
GO:0005622	0.938	intracellular anatomical structure
GO:0031982	0.902	vesicle
GO:0005737	0.871	cytoplasm
GO:0043229	0.865	intracellular organelle
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0032991	0.830	protein-containing complex
GO:0012505	0.600	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]