StarFunc result for job id G9CGD6

User Input

>input (899 residues)
MEPVTKWSPKQVVDWTRGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQE
LVLEAVDLLCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEF
LTSVVELIGAAKALLAWLDRAPFTGITDFSVTKNKIIQLCLDLTTTVQKDCFVAEMEDKV
LTVVKVLNGICDKTIRSTTDPVMSQCACLEEVHLPNIKPGEGLGMYIKSTYDGLHVITGT
TENSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGSFNFT
PAPLKNLRWKPPLVQTSPPPATTQSPESTMDTSLKKEKSAILDLYIPPPPAVPYSPRDEN
GSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMR
EKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKAFVSTKMTSYMAIDGSALVPLRQK
PRRKTQGFLTMSRRRISCKDLGHADCQGWLYKKKEKGSFLSNKWKKFWVILKGSSLYWYS
NQMAEKADGFVNLPDFTVERASECKKKHAFKISHPQIKTFYFAAENVQEMNVWLNKLGSA
VIHQESTTKDEECYSESEQEDPEIAAETPPPPHASQTQSLTAQQASSSSPSLSGTSYSFS
SLENTVKTPSSFPSSLSKERQSLPDTVNSLSAAEDEGQPITFAVQVHSPVPSEAGIHKAL
ENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKEETKVSEDDEMEKLYK
SLEQASLSPLGDRRPSTKKELRKSFVKRCKNPSINEKLHKIRTLNSTLKCKEHDLAMINQ
LLDDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSSPSVENSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G9CGD6	1.000	1.000	0.000	899	1.000	1.000	G9CGD6.pdb.gz	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
2	AFDB:Q8WXI2	0.366	0.321	1.525E-72	1034	0.508	0.442	Q8WXI2.pdb.gz	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
3	AFDB:Q6P9H4	0.357	0.570	2.815E-66	555	0.523	0.847	Q6P9H4.pdb.gz	CNKR3_HUMAN Connector enhancer of kinase suppressor of ras 3 OS=Homo sapiens OX=9606 GN=CNKSR3 PE=1 SV=1
4	PDB:6bbpA	0.104	0.178	3.132E-6	520	0.023	0.040	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
5	PDB:3ljuX	0.102	0.239	2.174E-5	373	0.026	0.062	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
6	PDB:6u3eA	0.103	0.228	2.666E-5	397	0.022	0.050	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
7	AFDB:B7WN72	0.085	0.067	1.242E-4	1140	0.136	0.107	B7WN72.pdb.gz	SHANK_CAEEL Protein shank OS=Caenorhabditis elegans OX=6239 GN=shn-1 PE=1 SV=1
8	AFDB:Q9ULL8	0.092	0.056	1.867E-4	1493	0.123	0.074	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
9	AFDB:A2ALU4	0.090	0.056	1.965E-4	1481	0.137	0.083	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
10	PDB:4mk0A	0.096	0.136	2.387E-4	631	0.018	0.025	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
11	AFDB:Q9H2D6	0.102	0.040	2.807E-4	2365	0.122	0.047	Q9H2D6.pdb.gz	TARA_HUMAN TRIO and F-actin-binding protein OS=Homo sapiens OX=9606 GN=TRIOBP PE=1 SV=3
12	PDB:7pc3A	0.092	0.200	3.080E-4	405	0.026	0.057	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:6t36A	0.091	0.800	4.632E-4	93	0.017	0.161	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
14	PDB:7p70A	0.089	0.193	6.965E-4	407	0.022	0.049	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:3uzsA	0.096	0.139	7.712E-4	609	0.024	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
16	PDB:2xkxA	0.092	0.114	8.987E-4	721	0.020	0.025	2xkxA.pdb.gz
17	PDB:5n7dA	0.094	0.194	9.952E-4	423	0.027	0.057	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
18	AFDB:Q9VUE8	0.089	0.032	1.435E-3	2637	0.115	0.039	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
19	AFDB:Q9H987	0.096	0.089	1.672E-3	977	0.112	0.103	Q9H987.pdb.gz	SYP2L_HUMAN Synaptopodin 2-like protein OS=Homo sapiens OX=9606 GN=SYNPO2L PE=1 SV=3
20	AFDB:Q09822	0.051	0.050	2.158E-3	927	0.128	0.124	Q09822.pdb.gz	CDC15_SCHPO Cell division control protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc15 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G9CGD6	0.0	1864	899	1.000	1.000	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
2	Q6P9H4	0.0	956	555	0.507	0.822	CNKR3_HUMAN Connector enhancer of kinase suppressor of ras 3 OS=Homo sapiens OX=9606 GN=CNKSR3 PE=1 SV=1
3	Q80VL0	0.0	628	406	0.360	0.798	ICEF1_RAT Interactor protein for cytohesin exchange factors 1 OS=Rattus norvegicus OX=10116 GN=Ipcef1 PE=1 SV=1
4	Q80YA9	0.0	554	1032	0.324	0.282	CNKR2_MOUSE Connector enhancer of kinase suppressor of ras 2 OS=Mus musculus OX=10090 GN=Cnksr2 PE=1 SV=1
5	Q8BMA3	0.0	862	555	0.473	0.766	CNKR3_MOUSE Connector enhancer of kinase suppressor of ras 3 OS=Mus musculus OX=10090 GN=Cnksr3 PE=1 SV=1
6	Q8WWN9	0.0	899	437	0.486	1.000	ICEF1_HUMAN Interactor protein for cytohesin exchange factors 1 OS=Homo sapiens OX=9606 GN=IPCEF1 PE=1 SV=1
7	Q8WXI2	0.0	554	1034	0.324	0.281	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
8	Q9Z1T4	0.0	554	1032	0.324	0.282	CNKR2_RAT Connector enhancer of kinase suppressor of ras 2 OS=Rattus norvegicus OX=10116 GN=Cnksr2 PE=1 SV=1
9	Q7KNQ9	3.23e-48	189	1557	0.113	0.066	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1
10	Q969H4	2.25e-46	180	720	0.121	0.151	CNKR1_HUMAN Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1 PE=1 SV=1
11	B6RSP1	5.18e-15	82.4	1197	0.040	0.030	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
12	Q6ZPK1	1.69e-12	73.9	1205	0.038	0.028	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
13	A0A0N4SUU0	1.96e-12	73.9	956	0.038	0.036	A0A0N4SUU0_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
14	E9Q6H8	2.15e-12	73.9	1269	0.038	0.027	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
15	B4DJX4	2.31e-12	73.6	977	0.040	0.037	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
16	A0A0N4SUV0	3.08e-12	72.4	525	0.038	0.065	A0A0N4SUV0_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
17	A0A0N4SW19	3.21e-12	72.4	531	0.038	0.064	A0A0N4SW19_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
18	A0A0N4SWD7	3.40e-12	73.2	1000	0.037	0.033	A0A0N4SWD7_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
19	Q9HAU0	3.77e-12	72.8	1116	0.040	0.032	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
20	Q9Y2H5	2.80e-10	66.6	1048	0.032	0.028	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06663 CNK2_3_dom	6.8e-54	194.3	Connector enhancer of kinase suppressor of ras 2/3 domain
2	PF10534 CRIC_ras_sig	9.3e-35	130.0	Connector enhancer of kinase suppressor of ras
3	PF00595 PDZ	1.4e-06	39.8	PDZ domain
4	PF13180 PDZ_2	18	17.1	PDZ domain
5	PF17820 PDZ_6	0.47	21.7	PDZ domain
6	PF02163 Peptidase_M50	1.9e+02	12.7	Peptidase family M50
7	PF00169 PH	8.7e-13	60.1	PH domain
8	PF15410 PH_9	24	16.5	Pleckstrin homology domain
9	PF00536 SAM_1	7.1e-13	60.1	SAM domain (Sterile alpha motif)
10	PF07647 SAM_2	1.7e-07	42.6	SAM domain (Sterile alpha motif)
11	PF02198 SAM_PNT	76	14.7	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10042.XP_006978137.1

Rank	PPI partner	STRING score	Description
1	10042.XP_006984363.1	0.698	DNA polymerase zeta catalytic subunit isoform X1
2	10042.XP_006979306.1	0.684	Alpha-(1,3)-fucosyltransferase 9
3	10042.XP_006982001.1	0.681	Cytohesin-2
4	10042.XP_006982455.1	0.660	Sterile alpha motif domain-containing protein 12
5	10042.XP_006979305.1	0.598	Glycoprotein endo-alpha-1,2-mannosidase
6	10042.XP_006981082.1	0.548	Complement component C8 gamma chain
7	10042.XP_006982713.1	0.538	Cytohesin-3
8	10042.XP_006990329.1	0.538	Cytohesin-1
9	10042.XP_006984395.1	0.537	Myristoylated alanine-rich C-kinase substrate
10	10042.XP_006984379.1	0.515	Collagen alpha-1(X) chain
11	10042.XP_006970915.1	0.500	Kinase suppressor of Ras 2
12	10042.XP_006977554.1	0.500	Kinase suppressor of Ras 1 isoform X1
13	10042.XP_006978610.1	0.500	RAF proto-oncogene serine/threonine-protein kinase
14	10042.XP_006990499.1	0.500	Serine/threonine-protein kinase B-raf
15	10042.XP_006991485.1	0.500	Serine/threonine-protein kinase A-Raf isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0019900	0.364	kinase binding
GO:0019901	0.330	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0048518	0.960	positive regulation of biological process
GO:0048583	0.923	regulation of response to stimulus
GO:0048584	0.913	positive regulation of response to stimulus
GO:0009987	0.872	cellular process
GO:0050794	0.821	regulation of cellular process
GO:0090287	0.677	regulation of cellular response to growth factor stimulus
GO:0023051	0.623	regulation of signaling
GO:0009966	0.613	regulation of signal transduction
GO:1902531	0.507	regulation of intracellular signal transduction
GO:0048522	0.497	positive regulation of cellular process
GO:0050896	0.490	response to stimulus
GO:0051716	0.318	cellular response to stimulus
GO:0043408	0.308	regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.996	plasma membrane
GO:0043226	0.995	organelle
GO:0005829	0.957	cytosol
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0030054	0.631	cell junction
GO:0012505	0.594	endomembrane system
GO:0031982	0.477	vesicle
GO:0045202	0.409	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]