StarFunc result for job id H0Y354

User Input

>input (149 residues)
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVVYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGV
NVLLRGNLPEIEESTDEDVLNISAEECIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0Y354	1.000	1.000	1.716E-27	149	1.000	1.000	H0Y354.pdb.gz	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
2	AFDB:A1KXW8	0.865	0.865	7.373E-23	149	0.872	0.872	A1KXW8.pdb.gz	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
3	AFDB:A0A087WSW5	0.418	0.641	6.628E-10	94	0.510	0.809	A0A087WSW5.pdb.gz	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
4	AFDB:Q9CZJ6	0.465	0.351	1.034E-3	204	0.154	0.113	Q9CZJ6.pdb.gz	MS18A_MOUSE Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1
5	AFDB:Q9P802	0.529	0.417	1.153E-3	194	0.121	0.093	Q9P802.pdb.gz	MIS18_SCHPO Kinetochore protein mis18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis18 PE=1 SV=2
6	AFDB:Q9NYP9	0.494	0.329	2.755E-3	233	0.134	0.086	Q9NYP9.pdb.gz	MS18A_HUMAN Protein Mis18-alpha OS=Homo sapiens OX=9606 GN=MIS18A PE=1 SV=1
7	PDB:6h0gB	0.434	0.189	4.428E-3	401	0.101	0.037	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
8	AFDB:A2AQ14	0.485	0.316	4.748E-3	241	0.128	0.079	A2AQ14.pdb.gz	MS18B_MOUSE Protein Mis18-beta OS=Mus musculus OX=10090 GN=Oip5 PE=2 SV=1
9	AFDB:A0A024R9N0	0.486	0.331	6.233E-3	229	0.114	0.074	A0A024R9N0.pdb.gz
10	AFDB:Q9VH36	0.458	0.134	6.949E-3	585	0.107	0.027	Q9VH36.pdb.gz	CRBN_DROME Protein cereblon OS=Drosophila melanogaster OX=7227 GN=ohgt PE=1 SV=1
11	AFDB:Q2V3E2	0.444	0.606	1.017E-2	105	0.094	0.133	Q2V3E2.pdb.gz	YIPL5_ARATH Protein yippee-like At4g27740 OS=Arabidopsis thaliana OX=3702 GN=At4g27740 PE=3 SV=1
12	PDB:2kv1A	0.375	0.434	2.266E-2	124	0.141	0.169	2kv1A.pdb.gz
13	PDB:5fqdE	0.413	0.193	2.266E-2	367	0.114	0.046	5fqdE.pdb.gz	Structural Basis of Lenalidomide-Induced Ck1Alpha Degradation by the Crl4(Crbn) Ubiquitin Ligase.
14	PDB:6h61A	0.310	0.083	1.366E-1	660	0.094	0.021	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
15	PDB:7bkpA	0.285	0.084	2.229E-1	689	0.094	0.020	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
16	PDB:7tnxA	0.408	0.114	8.691E-1	647	0.101	0.023	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
17	PDB:6symA	0.344	0.371	1.023	135	0.087	0.096	6symA.pdb.gz	Structure of Peptide methionine sulfoxide reductase MsrB at 1.63 Angstrom resolution
18	PDB:6j6qF	0.138	0.129	1.498	161	0.067	0.062	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
19	PDB:1x0tA	0.171	0.225	1.582	106	0.060	0.085	1x0tA.pdb.gz	Crystal Structure of a Ribonuclease P Protein Ph1601p from Pyrococcus horikoshii OT3: An Archaeal Homologue of Human Nuclear Ribonuclease P Protein Rpp21(,)
20	PDB:6jlaD	0.143	0.117	1.764	188	0.101	0.080	6jlaD.pdb.gz	Structures of three ependymin-related proteins suggest their function as a hydrophobic molecule binder.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y354	7.85e-108	305	149	1.000	1.000	FA72C_HUMAN Protein FAM72C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=2
2	Q6L9T8	1.08e-106	302	149	0.993	0.993	FA72D_HUMAN Protein FAM72D OS=Homo sapiens OX=9606 GN=FAM72D PE=1 SV=1
3	Q5TYM5	2.19e-104	296	149	0.980	0.980	FA72A_HUMAN Protein FAM72A OS=Homo sapiens OX=9606 GN=FAM72A PE=1 SV=1
4	Q86X60	3.27e-103	293	149	0.966	0.966	FA72B_HUMAN Protein FAM72B OS=Homo sapiens OX=9606 GN=FAM72B PE=1 SV=2
5	A1KXW8	1.48e-91	264	149	0.872	0.872	FA72A_RAT Protein FAM72A OS=Rattus norvegicus OX=10116 GN=Fam72a PE=1 SV=1
6	A0A087WSW5	8.31e-49	154	94	0.510	0.809	A0A087WSW5_HUMAN Family with sequence similarity 72 member C OS=Homo sapiens OX=9606 GN=FAM72C PE=3 SV=1
7	A0A087WZP4	8.98e-49	154	94	0.510	0.809	A0A087WZP4_HUMAN Family with sequence similarity 72 member B OS=Homo sapiens OX=9606 GN=FAM72B PE=3 SV=1
8	Q8IAM0	1.6	31.2	1397	0.107	0.011	Q8IAM0_PLAF7 Glutamate dehydrogenase, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0802000 PE=3 SV=1
9	Q57984	4.2	29.6	892	0.141	0.024	SYA_METJA Alanine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=alaS PE=1 SV=1
10	Q1ECF1	6.9	28.9	211	0.101	0.071	PYL7_ARATH Abscisic acid receptor PYL7 OS=Arabidopsis thaliana OX=3702 GN=PYL7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14976 FAM72	3.9e-70	246.1	FAM72 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463032

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477695	0.603	Ankyrin repeat domain-containing protein 20A1
2	9606.ENSP00000349891	0.601	Ankyrin repeat domain-containing protein 20A4
3	9606.ENSP00000366826	0.595	Ankyrin repeat domain-containing protein 20A2
4	9606.ENSP00000481934	0.571	Rho GTPase-activating protein 11B
5	9606.ENSP00000366608	0.569	COBW domain-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.978	positive regulation of cellular process
GO:0009966	0.970	regulation of signal transduction
GO:0048523	0.960	negative regulation of cellular process
GO:0060255	0.871	regulation of macromolecule metabolic process
GO:0044092	0.867	negative regulation of molecular function
GO:0050790	0.842	regulation of catalytic activity
GO:0010605	0.834	negative regulation of macromolecule metabolic process
GO:0051172	0.822	negative regulation of nitrogen compound metabolic process
GO:0031399	0.818	regulation of protein modification process
GO:0051348	0.789	negative regulation of transferase activity
GO:0031400	0.787	negative regulation of protein modification process
GO:0031323	0.784	regulation of cellular metabolic process
GO:0001932	0.743	regulation of protein phosphorylation
GO:0050732	0.709	negative regulation of peptidyl-tyrosine phosphorylation
GO:0010469	0.707	regulation of signaling receptor activity
GO:0061097	0.707	regulation of protein tyrosine kinase activity
GO:0033673	0.707	negative regulation of kinase activity
GO:0009987	0.704	cellular process
GO:0043067	0.639	regulation of programmed cell death
GO:0006469	0.599	negative regulation of protein kinase activity
GO:0010942	0.577	positive regulation of cell death
GO:0048585	0.550	negative regulation of response to stimulus
GO:0023057	0.539	negative regulation of signaling
GO:0010648	0.539	negative regulation of cell communication
GO:0043068	0.539	positive regulation of programmed cell death
GO:0042981	0.515	regulation of apoptotic process
GO:0016043	0.316	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]