StarFunc result for job id H7BZ55

User Input

>input (1653 residues)
MSSASSEPGNGDASQQPLLGLDTVIQRLEDTILSPTASREDRALTVRGEGRQASPTPVPT
RIREIVAGSLSEEPPQAGVQEPTATVARVQEENELLQEELTRLGDLLAQASAERDELASR
CRVVSEQLQARLETTEAQLRRSELEHSVDLEEALGRLEAAEERSTGLCQVNALLREQLEH
MKKANDALGRELAGMTGSVQRLQGELELRRWAQRQTRSGGLGQPRDLLLLWRQAVVLGTD
LAELRVATERGLADLQADTARTARRLHTACLNLDSNLRLSASSTASTLGQQLRDKAGEML
QLQGRWDAEKVALQARLSEQTLLVEKLTEQNEQKAKTIAALRTDLQNLVAQEDARCLELA
GSSITELGEPRRPLRSPQRATSPHQGASPPHICSPATLDPALQAMRAAIERRWRREQELC
LQLKSSQALVASLQEQLSESRRELWAAQKLQQERAREQAREREALRGQLEAQRLEVQQCR
ASCKLLGREKAALEMVVEELKGKADAADAEKQGLEAEAAELQRSLLLQAERREELALRRE
RSCRALETSQGRLQQLEEKVSGLREELASVREALSTAQLQRDVVESEREGLRSALARAEC
SNADLELLVRRLKSEGVEQRDSLAAMAALMEGLAQDKSALNHLALQLEQERDQLREQRKT
LEQERARAGEQLAQAEQQLALERAERRGLQQACGRLEQRQEQLEGQAALLGREKAQLQEQ
VGQVTCQKQALEEQLAQSLQDQEAQMGTLQQALQGKDALSEERAQLLAKQEALERQGRLA
AEEAADLRVERDSLESSLLEAQQLATKLQEQLEEEARSAGLARQALQVEMEQLQSDWEVQ
EMKLRQDTVRLQRQVAQQEREAQRALESQALAHREALAQLQREKETLSLTLAEEKEVARC
QLEQEKELVTKSAAEREALKGEIQSLKQERDESLLQLEHKMQQALSLKETERSLLSEELS
RARRTLERVQQEAQSQQEQAQATISATTEELKALQAQFEDAITAHQRETTALRESLQDLA
AERGDVEREAERLRAQLTVAQEGLAALRQELQGVEESREGLHREAQEARRALSDEAREKD
VLLLFNSELRATICRAEQEKASFKRSKEEKEQKLLILEEAQAALQQEASALRAHLWELEQ
AGGDARQELRELHRQVRTLKAENQRRSGEAHELQAQCSQEVLELRRQAAKAEAKHEGARK
EVLGLQRKLAEVEAAGEAHGQRLQEHLRESRGAEQTLRAELHSVTRKLQEASGVADALQA
RLDQACHRIHSLEQELAQAEGARQDAEAQLGRLCSTLRRGLGLQRQSPWASPEQPGSPTK
GSDSSQALPGQQGTSPPARPHSPLRWPSPTPGGRSSELMDVATVQDILRDFVQKLREAQR
ERDDSRIQMATLSSRLSEAECRCARAQSRVGQLQKALAEAEEGQRRVEGALSSARAARAL
QKEALRRLELEHLASVRAAGQEKRRLQEQLETLRQALEESRRHSQGLAKQGKLLEEQLTN
LEHRCQKAEVSLEPLRQMEQETLKREEDVARLGAEKEQLDQSLNSLHQEVDGALRQNQQL
QAQMTEMEQAHTQRLQDLTAQHQRDLATEAERLHGARPQATQALESQEWTHQQQVKVLEE
QVASLKEQLDQEVQWRQQAHLGQAFQTGHAQRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TZA2	0.085	0.073	3.698E-38	2017	0.381	0.312	Q5TZA2.pdb.gz	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
2	AFDB:E7F2T0	0.092	0.081	8.484E-36	1959	0.324	0.274	E7F2T0.pdb.gz	E7F2T0_DANRE Ciliary rootlet coiled-coil, rootletin family member 2 OS=Danio rerio OX=7955 GN=crocc2 PE=4 SV=1
3	AFDB:Q8CJ40	0.070	0.061	2.033E-34	2009	0.365	0.300	Q8CJ40.pdb.gz	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2
4	AFDB:Q60952	0.063	0.046	1.170E-10	2414	0.246	0.168	Q60952.pdb.gz	CP250_MOUSE Centrosome-associated protein CEP250 OS=Mus musculus OX=10090 GN=Cep250 PE=1 SV=4
5	AFDB:Q9BV73	0.073	0.054	3.374E-10	2442	0.244	0.165	Q9BV73.pdb.gz	CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2
6	AFDB:Q9VCD1	0.108	0.093	3.926E-7	2048	0.217	0.175	Q9VCD1.pdb.gz	Q9VCD1_DROME Rootletin, isoform D OS=Drosophila melanogaster OX=7227 GN=Root PE=4 SV=3
7	AFDB:F4HZS8	0.074	0.063	4.903E-4	1999	0.177	0.147	F4HZS8.pdb.gz	F4HZS8_ARATH Sporulation-specific protein OS=Arabidopsis thaliana OX=3702 GN=At1g22060 PE=1 SV=1
8	AFDB:Q09EF7	0.070	0.061	3.539E-3	1955	0.180	0.152	Q09EF7.pdb.gz	CROCC_CAEEL Rootletin OS=Caenorhabditis elegans OX=6239 GN=che-10 PE=2 SV=2
9	AFDB:Q15643	0.068	0.058	1.795E-2	1979	0.179	0.150	Q15643.pdb.gz	TRIPB_HUMAN Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3
10	AFDB:Q9Z0H8	0.069	0.102	4.822E-2	1047	0.084	0.133	Q9Z0H8.pdb.gz	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
11	PDB:3jcmI	0.026	0.063	3.276	416	0.012	0.048	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
12	PDB:7w5a2	0.053	0.456	7.643	123	0.011	0.146	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:7rroP	0.057	0.177	8.802	373	0.033	0.145	7rroP.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CJ40	8.49e-164	549	2009	0.321	0.264	CROCC_MOUSE Rootletin OS=Mus musculus OX=10090 GN=Crocc PE=1 SV=2
2	Q5TZA2	3.94e-149	507	2017	0.322	0.264	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
3	B1AKD8	2.83e-145	484	1311	0.306	0.386	B1AKD8_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
4	E7F2T0	1.18e-141	485	1959	0.293	0.248	E7F2T0_DANRE Ciliary rootlet coiled-coil, rootletin family member 2 OS=Danio rerio OX=7955 GN=crocc2 PE=4 SV=1
5	A0A087WW81	8.16e-57	215	838	0.140	0.276	A0A087WW81_HUMAN Ciliary rootlet coiled-coil, rootletin (Fragment) OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=6
6	Q9BV73	1.18e-42	174	2442	0.239	0.162	CP250_HUMAN Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2
7	Q60952	3.74e-42	172	2414	0.246	0.168	CP250_MOUSE Centrosome-associated protein CEP250 OS=Mus musculus OX=10090 GN=Cep250 PE=1 SV=4
8	Q9VCD1	4.15e-24	113	2048	0.155	0.125	Q9VCD1_DROME Rootletin, isoform D OS=Drosophila melanogaster OX=7227 GN=Root PE=4 SV=3
9	Q8MSN3	4.96e-21	103	1230	0.109	0.147	Q8MSN3_DROME AT16851p OS=Drosophila melanogaster OX=7227 GN=Root PE=2 SV=1
10	Q382P4	1.58e-07	58.9	1299	0.046	0.059	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
11	Q86T23	5.16e-06	49.3	111	0.019	0.288	CROL1_HUMAN Putative ciliary rootlet coiled-coil protein-like 1 protein OS=Homo sapiens OX=9606 GN=CROCCP2 PE=5 SV=1
12	P55937	7.54e-06	53.5	1487	0.070	0.078	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
13	H2L0I2	0.002	45.4	2396	0.038	0.026	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
14	H2L0I3	0.002	45.4	2323	0.048	0.034	H2L0I3_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
15	H2L0I4	0.002	45.4	2392	0.038	0.026	H2L0I4_CAEEL Lin-5 OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=2
16	I3LSP4	0.24	38.5	1005	0.027	0.045	I3LSP4_PIG Golgin subfamily A member 2 OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=2
17	F1RRA0	0.34	38.1	872	0.027	0.052	F1RRA0_PIG Golgin subfamily A conserved domain-containing protein OS=Sus scrofa OX=9823 GN=GOLGA2 PE=1 SV=4
18	Q9Z221	0.35	38.1	971	0.029	0.049	PMFBP_RAT Polyamine-modulated factor 1-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pmfbp1 PE=2 SV=2
19	Q9WVQ0	0.40	37.7	1022	0.047	0.075	PMFBP_MOUSE Polyamine-modulated factor 1-binding protein 1 OS=Mus musculus OX=10090 GN=Pmfbp1 PE=2 SV=1
20	Q8TZY2	0.54	37.4	1177	0.081	0.114	SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=smc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11932 DUF3450	6.8	17.5	Protein of unknown function (DUF3450)
2	PF15035 Rootletin	1.8e-12	59.2	Ciliary rootlet component, centrosome cohesion

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373586	0.594	Uncharacterized protein C2orf54
2	9606.ENSP00000306760	0.530	Leucine-rich repeat-containing protein 45
3	9606.ENSP00000006658	0.524	Spermatogenesis-associated protein 20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.971	cellular component organization
GO:0007010	0.946	cytoskeleton organization
GO:0000226	0.927	microtubule cytoskeleton organization
GO:0050789	0.805	regulation of biological process
GO:0050794	0.802	regulation of cellular process
GO:0051179	0.488	localization
GO:0051641	0.304	cellular localization
GO:0031023	0.302	microtubule organizing center organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0005856	0.995	cytoskeleton
GO:0005815	0.985	microtubule organizing center
GO:0043227	0.957	membrane-bounded organelle
GO:0005813	0.927	centrosome
GO:0016020	0.919	membrane
GO:0071944	0.913	cell periphery
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0005886	0.540	plasma membrane
GO:0005634	0.385	nucleus
GO:0070013	0.321	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]