StarFunc result for job id I0J062

User Input

>input (215 residues)
MGVRLRVWPAAPHSISRCPRPLGAVLSILLAGGSRKGTPTARCLGQRTKEKRVGGRSLRS
EAGSGPCPTAGAQPTAPSSAWPPRLRPRTCPQMSGELPRVRPTRVGLSSLGSGPGHPPSG
TRMCGERARNRRGRARRLTPEQPRIGASAGPGPPLPPARPRCSGSCHLPRPPQHLSPPQP
GRVRMGAAEGSRRADTHHARRRRRARLPAPRSAST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:I0J062	0.999	0.999	9.160E-31	215	1.000	1.000	I0J062.pdb.gz	PANO1_HUMAN Proapoptotic nucleolar protein 1 OS=Homo sapiens OX=9606 GN=PANO1 PE=2 SV=1
2	AFDB:Q13351	0.108	0.081	2.473	362	0.219	0.130	Q13351.pdb.gz	KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens OX=9606 GN=KLF1 PE=1 SV=1
3	AFDB:O15743	0.145	0.049	6.579	975	0.116	0.026	O15743.pdb.gz	SPNA_DICDI Protein spalten OS=Dictyostelium discoideum OX=44689 GN=spnA PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	I0J062	4.26e-142	397	215	1.000	1.000	PANO1_HUMAN Proapoptotic nucleolar protein 1 OS=Homo sapiens OX=9606 GN=PANO1 PE=2 SV=1
2	Q24574	1.7	32.3	1556	0.112	0.015	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
3	Q60710	2.2	31.6	658	0.088	0.029	SAMH1_MOUSE Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Mus musculus OX=10090 GN=Samhd1 PE=1 SV=3
4	O53146	2.4	31.2	328	0.060	0.040	O53146_MYCTU Probable quinone reductase Qor (NADPH:quinone reductase) (Zeta-crystallin homolog protein) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=qor PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369431	0.556	Caspase activity and apoptosis inhibitor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.494	catalytic activity
GO:1901363	0.430	heterocyclic compound binding
GO:0097159	0.430	organic cyclic compound binding
GO:0016787	0.338	hydrolase activity
GO:0140096	0.320	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0045861	0.986	negative regulation of proteolysis
GO:0048518	0.979	positive regulation of biological process
GO:0042981	0.977	regulation of apoptotic process
GO:0048523	0.976	negative regulation of cellular process
GO:0048522	0.970	positive regulation of cellular process
GO:0043068	0.963	positive regulation of programmed cell death
GO:0031323	0.962	regulation of cellular metabolic process
GO:0043065	0.931	positive regulation of apoptotic process
GO:1903050	0.788	regulation of proteolysis involved in protein catabolic process
GO:0009894	0.759	regulation of catabolic process
GO:0065008	0.707	regulation of biological quality
GO:0042176	0.707	regulation of protein catabolic process
GO:0031647	0.692	regulation of protein stability
GO:0061136	0.692	regulation of proteasomal protein catabolic process
GO:0009895	0.691	negative regulation of catabolic process
GO:1903051	0.656	negative regulation of proteolysis involved in protein catabolic process
GO:0042177	0.652	negative regulation of protein catabolic process
GO:0031329	0.637	regulation of cellular catabolic process
GO:0032434	0.627	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:1901799	0.584	negative regulation of proteasomal protein catabolic process
GO:0009987	0.583	cellular process
GO:0031330	0.506	negative regulation of cellular catabolic process
GO:0050790	0.489	regulation of catalytic activity
GO:0009893	0.420	positive regulation of metabolic process
GO:0051173	0.364	positive regulation of nitrogen compound metabolic process
GO:0023051	0.349	regulation of signaling
GO:0048583	0.325	regulation of response to stimulus
GO:0010646	0.325	regulation of cell communication
GO:0010604	0.322	positive regulation of macromolecule metabolic process
GO:0052548	0.316	regulation of endopeptidase activity
GO:0006915	0.306	apoptotic process
GO:2000059	0.302	negative regulation of ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	0.998	nucleolus
GO:0005737	0.942	cytoplasm
GO:0005654	0.560	nucleoplasm
GO:0005829	0.501	cytosol
GO:0005739	0.395	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.338	Hydrolases.

[back to server]