StarFunc result for job id K9M1U5

User Input

>input (179 residues)
MRPSVWAAVAAGLWVLCTVIAAAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQR
NCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVA
ACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:K9M1U5	1.000	1.000	1.572E-26	179	1.000	1.000	K9M1U5.pdb.gz	IFNL4_HUMAN Interferon lambda-4 OS=Homo sapiens OX=9606 GN=IFNL4 PE=2 SV=1
2	AFDB:Q8IZJ0	0.658	0.595	1.018E-4	200	0.246	0.220	Q8IZJ0.pdb.gz	IFNL2_HUMAN Interferon lambda-2 OS=Homo sapiens OX=9606 GN=IFNL2 PE=2 SV=1
3	AFDB:F1PY54	0.664	0.629	1.133E-4	190	0.257	0.242	F1PY54.pdb.gz	F1PY54_CANLF Interferon 1IB3 OS=Canis lupus familiaris OX=9615 GN=IF1IB3 PE=3 SV=2
4	AFDB:Q8IU54	0.694	0.627	1.195E-4	200	0.251	0.225	Q8IU54.pdb.gz	IFNL1_HUMAN Interferon lambda-1 OS=Homo sapiens OX=9606 GN=IFNL1 PE=1 SV=1
5	AFDB:Q4VK74	0.682	0.636	2.153E-4	193	0.223	0.207	Q4VK74.pdb.gz	IFNL2_MOUSE Interferon lambda-2 OS=Mus musculus OX=10090 GN=Ifnl2 PE=2 SV=2
6	AFDB:B4ER10	0.680	0.657	5.072E-4	186	0.207	0.199	B4ER10.pdb.gz	IFNL3_CHICK Interferon lambda-3 OS=Gallus gallus OX=9031 GN=IFNL3 PE=2 SV=1
7	PDB:5t5wC	0.614	0.718	7.994E-4	151	0.223	0.265	5t5wC.pdb.gz
8	PDB:3og6A	0.581	0.712	5.796E-3	143	0.229	0.287	3og6A.pdb.gz
9	AFDB:Q1JQ34	0.377	0.338	6.989E-2	210	0.173	0.148	Q1JQ34.pdb.gz	Q1JQ34_DANRE Growth hormone 1 OS=Danio rerio OX=7955 GN=ghl PE=2 SV=1
10	AFDB:Q8NEV9	0.394	0.317	1.737E-1	243	0.179	0.132	Q8NEV9.pdb.gz	IL27A_HUMAN Interleukin-27 subunit alpha OS=Homo sapiens OX=9606 GN=IL27 PE=1 SV=2
11	AFDB:Q8K3I6	0.365	0.311	2.526E-1	234	0.184	0.141	Q8K3I6.pdb.gz	IL27A_MOUSE Interleukin-27 subunit alpha OS=Mus musculus OX=10090 GN=Il27 PE=1 SV=1
12	AFDB:C5VUR1	0.432	0.445	2.812E-1	173	0.162	0.168	C5VUR1.pdb.gz	C5VUR1_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il-22 PE=2 SV=1
13	PDB:7z0lB	0.378	0.218	3.982E-1	370	0.140	0.068	7z0lB.pdb.gz
14	PDB:1bp3A	0.320	0.316	4.201E-1	186	0.117	0.113	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
15	PDB:6weoQ	0.449	0.543	7.570E-1	142	0.134	0.169	6weoQ.pdb.gz	The tissue protective functions of interleukin-22 can be decoupled from pro-inflammatory actions through structure-based design.
16	PDB:1cnt2	0.319	0.419	9.894E-1	130	0.112	0.154	1cnt2.pdb.gz
17	PDB:1rhgB	0.403	0.474	1.044	144	0.140	0.174	1rhgB.pdb.gz
18	PDB:7zxkC	0.329	0.348	1.044	166	0.162	0.175	7zxkC.pdb.gz
19	PDB:1cnt1	0.387	0.449	2.330	150	0.117	0.140	1cnt1.pdb.gz
20	PDB:1f6fA	0.359	0.353	2.458	183	0.123	0.120	1f6fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K9M1U5	7.55e-124	348	179	1.000	1.000	IFNL4_HUMAN Interferon lambda-4 OS=Homo sapiens OX=9606 GN=IFNL4 PE=2 SV=1
2	F1PY54	4.22e-05	44.3	190	0.285	0.268	F1PY54_CANLF Interferon 1IB3 OS=Canis lupus familiaris OX=9615 GN=IF1IB3 PE=3 SV=2
3	Q4VK74	6.26e-05	43.9	193	0.251	0.233	IFNL2_MOUSE Interferon lambda-2 OS=Mus musculus OX=10090 GN=Ifnl2 PE=2 SV=2
4	Q8IZI9	0.001	40.4	196	0.263	0.240	IFNL3_HUMAN Interferon lambda-3 OS=Homo sapiens OX=9606 GN=IFNL3 PE=1 SV=2
5	Q8IU54	0.003	39.3	200	0.279	0.250	IFNL1_HUMAN Interferon lambda-1 OS=Homo sapiens OX=9606 GN=IFNL1 PE=1 SV=1
6	Q8IZJ0	0.011	37.4	200	0.251	0.225	IFNL2_HUMAN Interferon lambda-2 OS=Homo sapiens OX=9606 GN=IFNL2 PE=2 SV=1
7	Q8CGK6	0.069	35.0	193	0.207	0.192	IFNL3_MOUSE Interferon lambda-3 OS=Mus musculus OX=10090 GN=Ifnl3 PE=2 SV=1
8	A0A1L8I2G6	8.9	29.3	3171	0.106	0.006	A0A1L8I2G6_XENLA Ciliogenesis and planar polarity effector 1 isoform X1 OS=Xenopus laevis OX=8355 GN=cplane1.L PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15177 IL28A	1e-35	134.4	Interleukin-28A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010379224.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010379257.1	0.603	Uncharacterized protein LOC104676193
2	61622.XP_010353646.1	0.566	Ral GTPase activating protein non-catalytic beta subunit
3	61622.XP_010379222.1	0.521	Interferon lambda-3-like
4	61622.XP_010379223.1	0.521	Interferon lambda-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0097696	0.990	receptor signaling pathway via STAT
GO:0051607	0.976	defense response to virus
GO:0007259	0.956	receptor signaling pathway via JAK-STAT
GO:0071704	0.575	organic substance metabolic process
GO:0044238	0.561	primary metabolic process
GO:0044237	0.561	cellular metabolic process
GO:0048518	0.554	positive regulation of biological process
GO:0048583	0.550	regulation of response to stimulus
GO:0006807	0.506	nitrogen compound metabolic process
GO:0018193	0.497	peptidyl-amino acid modification
GO:0006468	0.490	protein phosphorylation
GO:0048584	0.480	positive regulation of response to stimulus
GO:0002684	0.429	positive regulation of immune system process
GO:0018212	0.329	peptidyl-tyrosine modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005615	0.998	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]