StarFunc result for job id M0QZD8

User Input

>input (1400 residues)
MPAPVGLLGLVLLWPLMAVTAEKIPDSQVGQVASCMTACTGSAGPHLPVGTRYTYHFSTN
TSTSLQDVLVEGSGLGLQGLAVLDVLGLCQMALWLQDFQVTSILGAKVELLKESESLSAT
LGRNPLRFILHSGRVAHLCPHPTEPRWVLNVKRAVLSLLQGHPGAHSPKTFDEVDILGRC
PTTYQHHGDWLHKTKDLARCSLRRGRSSLHSQALPGVAPGLTSRLTCVQSFRAGVLREAS
CTELDSAGPLPAKASAVQMRTLSSLSLLHEMPQDPAGTDPDDRDDEDMTPSSLLYEWEET
PSQAMVATAATLVRRLCLAQTTSLEAMDLFLTLVSQLQGLSGGELMELWQYSSFKCRDNG
QPLLDALPSCGTEHCVGLMKELIASAAVEADEVEAWLSSLAFLPQPTDAMVHMLLPLLQT
PRASPGAFLGISALVHNLCASLDGPCGQLPGVGSLVRILGDALGENCTIQEPSDDDKLQL
VLKAVGNAGLAAMALTPTLSACASLRSSTPEIRLGAIQAFRRVPCSADRSVLSRLYQSLE
EDAEIRINAYLALMRCPSEEVFAQVRRTQAGELSTQVGSFVWSHILQLLETHDPLKRALR
DTLPEDILSQEFHPEMWKHSSYSDVTFRSVSGSLGANLEGTLLFSPASFLPRSATVNLTI
HTMGRAFNLLELGLRLENAEEIAHRLFGRKSFWGQEDGREPEPEEPPGPEPGPAPQPASP
ECPGDRDRRMRYLQQKVTRRRGARQALRCELSVKLLGQELSFVNCGATGSHVNHWPLNLA
ELAIKLMKGQEVQMNRRLSLAAQELVFPTVSGLPARLTLNASAAISIRVRGTTDFQQRSD
FSVNGYVKPSALLQISAQMGTAGILGQAGLRWVTSVRSAASLDGGIQVQKGRVLKVHLNT
PEEAVELLSFSSQLYLITRDGVRSLRHVPGPSEVQSCTGEEVSYTWGWRLCTGVTWPVPG
QPYLLSLPVFAAVTLQKRDPGLRQYLLEAAYTLQPQKGSWFPQEATAHVFMGTPGSEVLR
DVGVDMSYSLPQNKFRLKLLHPKKKIELDGKMEALGSAHTGHLELVLDDRDVYYIKGWSD
LQPAMGGEAERFQAQLEVKLVTGGSPVVFTGNLTRQVGSKLAFSASLSHLLSDQANVTAL
LERKEENGRRVAALGAELFVPGLVGLRALGLLQQRGQLWTNSLRIQYSLLGQAKQAAHEC
STSQKLRADSGSDGAYRLELRHELHCTQILAFSHKVQLWHEEDSGHLHSQLEVSYGKHWD
KNSNKRHLRVSQTFKNDSGPALSNHFMEFVLQVPERQVDCRVQLYHLSLRLPYVESSSHL
KVQYNGRPLFVAGGQWKDTSRATLWKWEGALNLDSPWLMVSAAHRLYWPHRAVFQAVLEL
TLGKAWTLKDLVVSVGCRSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6RG02	0.393	0.236	3.722E-52	2586	0.195	0.106	Q6RG02.pdb.gz	VIT_PENME Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2
2	AFDB:Q92093	0.500	0.430	3.414E-46	1659	0.181	0.153	Q92093.pdb.gz	VIT_ONCMY Vitellogenin OS=Oncorhynchus mykiss OX=8022 GN=vtg1 PE=1 SV=1
3	AFDB:Q1MTC4	0.498	0.434	1.449E-45	1631	0.170	0.146	Q1MTC4.pdb.gz	Q1MTC4_DANRE Vitellogenin 2 OS=Danio rerio OX=7955 GN=si:dkey-4c23.2 PE=1 SV=1
4	AFDB:Q1LWN2	0.516	0.528	1.002E-42	1362	0.157	0.162	Q1LWN2.pdb.gz	Q1LWN2_DANRE Vitellogenin 1 OS=Danio rerio OX=7955 GN=vg1 PE=1 SV=1
5	AFDB:F1QQQ3	0.546	0.603	1.577E-40	1253	0.133	0.148	F1QQQ3.pdb.gz	F1QQQ3_DANRE Vitellogenin 3, phosvitinless OS=Danio rerio OX=7955 GN=cb1001 PE=1 SV=3
6	AFDB:P18948	0.515	0.446	1.109E-39	1651	0.138	0.117	P18948.pdb.gz	VIT6_CAEEL Vitellogenin-6 OS=Caenorhabditis elegans OX=6239 GN=vit-6 PE=1 SV=5
7	AFDB:P05690	0.528	0.464	3.928E-39	1613	0.133	0.115	P05690.pdb.gz	VIT2_CAEEL Vitellogenin-2 OS=Caenorhabditis elegans OX=6239 GN=vit-2 PE=1 SV=5
8	AFDB:Q9VF24	0.516	0.494	9.194E-37	1470	0.128	0.122	Q9VF24.pdb.gz	Q9VF24_DROME Crossveinless d OS=Drosophila melanogaster OX=7227 GN=cv-d PE=1 SV=2
9	AFDB:Q7Z1M0	0.542	0.468	1.862E-34	1641	0.133	0.113	Q7Z1M0.pdb.gz	VIT1_SOLIN Vitellogenin-1 OS=Solenopsis invicta OX=13686 PE=2 SV=1
10	AFDB:A8MUN2	0.389	0.610	4.906E-31	828	0.117	0.198	A8MUN2.pdb.gz	A8MUN2_HUMAN Apolipoprotein B OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2
11	PDB:6i7sG	0.414	0.633	2.387E-27	863	0.104	0.169	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
12	PDB:6u62A	0.121	0.145	2.907E-3	1110	0.071	0.089	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
13	PDB:5cslB	0.058	0.046	1.107E-2	2072	0.079	0.053	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
14	PDB:6bcuW	0.124	0.154	1.147E-2	1052	0.060	0.080	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
15	PDB:1qbkB	0.128	0.189	2.935E-2	880	0.040	0.064	1qbkB.pdb.gz	Structure of the nuclear transport complex karyopherin-beta2-Ran x GppNHp.
16	PDB:5wbjA	0.120	0.149	3.392E-2	1058	0.059	0.078	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
17	PDB:5a1uE	0.079	0.115	4.213E-2	824	0.074	0.126	5a1uE.pdb.gz
18	PDB:4abnB	0.093	0.227	4.368E-2	426	0.039	0.127	4abnB.pdb.gz
19	PDB:4tnmA	0.112	0.280	5.832E-2	407	0.031	0.106	4tnmA.pdb.gz
20	PDB:4d4zB	0.090	0.335	7.244E-2	290	0.027	0.131	4d4zB.pdb.gz	Crystal Structure of the Peroxo-Diiron(III) Intermediate of Deoxyhypusine Hydroxylase, an Oxygenase Involved in Hypusination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6RG02	7.62e-61	233	2586	0.167	0.090	VIT_PENME Vitellogenin OS=Penaeus merguiensis OX=71412 PE=1 SV=2
2	Q7KTG2	1.05e-52	207	4333	0.116	0.038	Q7KTG2_DROME Apolipoprotein lipid transfer particle OS=Drosophila melanogaster OX=7227 GN=Apoltp PE=1 SV=2
3	Q9V496	2.37e-49	196	3351	0.186	0.078	APLP_DROME Apolipophorins OS=Drosophila melanogaster OX=7227 GN=apolpp PE=1 SV=2
4	P04114	4.03e-35	149	4563	0.141	0.043	APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2
5	A8MUN2	1.78e-34	145	828	0.116	0.196	A8MUN2_HUMAN Apolipoprotein B OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2
6	E9Q414	3.87e-31	136	4505	0.145	0.045	APOB_MOUSE Apolipoprotein B-100 OS=Mus musculus OX=10090 GN=Apob PE=1 SV=1
7	Q7TMA5	9.78e-30	132	4743	0.141	0.042	APOB_RAT Apolipoprotein B-100 OS=Rattus norvegicus OX=10116 GN=Apob PE=1 SV=1
8	Q5TZ29	3.01e-21	103	3730	0.136	0.051	Q5TZ29_DANRE Apolipoprotein Bb, tandem duplicate 1 OS=Danio rerio OX=7955 GN=apobb PE=1 SV=1
9	Q92093	8.85e-21	102	1659	0.138	0.116	VIT_ONCMY Vitellogenin OS=Oncorhynchus mykiss OX=8022 GN=vtg1 PE=1 SV=1
10	A0A0R4IVV0	1.11e-14	82.0	884	0.116	0.184	MTP_DANRE Microsomal triglyceride transfer protein large subunit OS=Danio rerio OX=7955 GN=mttp PE=1 SV=1
11	Q1MTC4	1.12e-11	72.4	1631	0.134	0.115	Q1MTC4_DANRE Vitellogenin 2 OS=Danio rerio OX=7955 GN=si:dkey-4c23.2 PE=1 SV=1
12	P55156	9.69e-09	62.4	887	0.087	0.138	MTP_BOVIN Microsomal triglyceride transfer protein large subunit (Fragment) OS=Bos taurus OX=9913 GN=MTTP PE=1 SV=1
13	Q1LWN2	1.82e-08	62.0	1362	0.134	0.138	Q1LWN2_DANRE Vitellogenin 1 OS=Danio rerio OX=7955 GN=vg1 PE=1 SV=1
14	D4A1W8	1.40e-07	58.9	896	0.026	0.040	MTP_RAT Microsomal triglyceride transfer protein large subunit OS=Rattus norvegicus OX=10116 GN=Mttp PE=1 SV=1
15	F1QQQ3	1.54e-07	58.9	1253	0.096	0.108	F1QQQ3_DANRE Vitellogenin 3, phosvitinless OS=Danio rerio OX=7955 GN=cb1001 PE=1 SV=3
16	E9PBP6	3.09e-07	57.4	811	0.029	0.049	E9PBP6_HUMAN Microsomal triglyceride transfer protein large subunit OS=Homo sapiens OX=9606 GN=MTTP PE=1 SV=2
17	P55157	3.52e-07	57.4	894	0.029	0.045	MTP_HUMAN Microsomal triglyceride transfer protein large subunit OS=Homo sapiens OX=9606 GN=MTTP PE=1 SV=1
18	O08601	6.06e-07	56.6	894	0.025	0.039	MTP_MOUSE Microsomal triglyceride transfer protein large subunit OS=Mus musculus OX=10090 GN=Mttp PE=1 SV=2
19	P05690	0.046	40.8	1613	0.032	0.028	VIT2_CAEEL Vitellogenin-2 OS=Caenorhabditis elegans OX=6239 GN=vit-2 PE=1 SV=5
20	P18948	0.078	40.0	1651	0.084	0.071	VIT6_CAEEL Vitellogenin-6 OS=Caenorhabditis elegans OX=6239 GN=vit-6 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01347 Vitellogenin_N	1.2e-50	184.3	Lipoprotein amino terminal region
2	PF09172 Vit_open_b-sht	5.9e-56	201.6	Vitellinogen, open beta-sheet

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350425	0.624	Apolipoprotein A-IV

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005319	0.989	lipid transporter activity
GO:0120013	0.872	lipid transfer activity
GO:0005548	0.351	phospholipid transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.883	cellular process
GO:0050896	0.613	response to stimulus
GO:0071704	0.361	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043227	0.988	membrane-bounded organelle
GO:0070013	0.988	intracellular organelle lumen
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0012505	0.975	endomembrane system
GO:0005576	0.958	extracellular region
GO:0005829	0.937	cytosol
GO:0005615	0.864	extracellular space
GO:0032991	0.774	protein-containing complex
GO:0031982	0.757	vesicle
GO:0097708	0.495	intracellular vesicle
GO:0031410	0.488	cytoplasmic vesicle
GO:0005788	0.477	endoplasmic reticulum lumen
GO:0016020	0.447	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]