StarFunc result for job id M0R2J8

User Input

>input (1783 residues)
MAKTGAEDHREALSQSSLSLLTEAMEVLQQSSPEGTLDGNTVNPIYKYILNDLPREFMSS
QAKAVIKTTDDYLQSQFGPNRLVHSAAVSEGSGLQDCSTHQTASDHSHDEISDLDSYKSN
SKNNSCSISASKRNRPVSAPVGQLRVAEFSSLKFQSARNWQKLSQRHKLQPRVIKVTAYK
NGSRTVFARVTVPTITLLLEECTEKLNLNMAARRVFLADGKEALEPEDIPHEADVYVSTG
EPFLNPFKKIKDHLLLIKKVTWTMNGLMLPTDIKRRKTKPVLSIRMKKLTERTSVRILFF
KNGMGQDGHEITVGKETMKKVLDTCTIRMNLNLPARYFYDLYGRKIEDISKVPLLEKCLQ
NSITPLRGLLWVSKGEGFSPSGAKMYIQGVLLALYQRLKSAKKYYKQLNLVMNEQKEKIT
EKVILSMTAKEHHKEQEEVSRLIDELQTAIKSNIGHLCKLGPQLQAEQEQFSSYVYQHIK
SLPANTLVPGGLQLKVFENGKNTGEISVGISKKDLGSDSPIQTDHMMERLLLKIHQRLQG
SSINPPGLNYSSMRLFDENGQEIKNPLSLKNEQKIWVSYGRAYRSPLNLALGLTFDRVSA
FARGDIMVAYKTFLDPNAVLLPGCGNWEVCEGFPINFNCTSQQIPDQFEKVDLENHFLQN
KVDPNIVLHASVSIGKWSFSGSEASSRSQIAPSILWPVASVWLITKTGMILSRAITQGCL
AIGHPIRVKAAEGTSLEGYKLILQKRHSGDDSQKWVFGTDGCIYSKAYPQFVLTYLEELN
AQVDVTQTEYHIHHGAWTTAHQEHGRNLAEEVLQESASNLGLKQLPEPSDTHLMPEGSLE
ETGELTVALVRKLEEKHPKASAQRWAIKHEGTSKPGQWKHSRVENPLWNKLTYMWPVLPS
GQLNEEFDWPIQGLLVPSSPPMKKPICKTTEPYAPVRLRVLQNGEKNKNRSVTILGPDIS
PGRKTQCTEILNLPSAARRLYNEKGKEIFALKDLQRDELVYVSCGELWINPDLSIAQQKK
QIFLRNLESDIAKIQIFCSTHKIEALVLEVQSDIVSGSKLAVHKPVAIFGEEKQVTEPEE
KQMQEDPLTTENASSEILDSHVRAHLRMKACHTLPRYAWQETSHDFDEDDSLPKKTEKGL
FENVEPQKKHSCSPKHSKLHKHCHQQFEYRDGQIISHAAPQLVLGVQGPNLRSGMEVVLV
EKKSDGSHQRWIHQEDSRTFHLVSNPDLVLAVSMTKTRNEVCGYPVIVQKYKPYNNGAAN
QKWHYMKNIKALVAFHSTALDKEITSANYAGVCTSSVIKEENIDQPGYCYLSPDGKRKTM
LCLACGQSMRTEKGLKQLLPGVPFLCISGTKTQKPFLQGPFKVISVAEVDLSCDKAEKTL
SYYQARLLSLRMKTCTQAASHSGMAATHQKAVKIIAYKNGDGYRNGKLIVAGTFPMLLTE
CTEQLGLARAASKVYTKDGTPIFTLRDLVLWALDESFLQRDSEKQKQDAAPVGKEQIIVE
KNPRMKVKNRLFAKSVTSDSLDGIDKSLLTLILRNPIAIWVSCGEPFLPPNALQKAEKLE
KQNWLKKDRILADLDTMRHKMRQLKGRRVAACQPATMVPTKSPVQPVVVEGGWTEQTQQE
IKLMELIRHTEAHLSEIQEMESKINFPIATKRIAVKPSNLYKQPNTKRVWIYLNGGRPED
GTYAWGKTISELLQDCSSRLKMTHPARALYTPSGEPIQSWDDIERDMVICVSMGHGFKTP
KELKQLMEIRANYARIRRQQGPQATDIVVSPSTKLLSLAHLHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0R2J8	1.000	1.000	0.000	1783	1.000	1.000	M0R2J8.pdb.gz	DCDC1_HUMAN Doublecortin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DCDC1 PE=1 SV=1
2	AFDB:Q95QC4	0.045	0.088	8.540E-6	802	0.029	0.065	Q95QC4.pdb.gz	DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans OX=6239 GN=zyg-8 PE=1 SV=1
3	PDB:6h0bB	0.049	0.156	3.377E-3	521	0.014	0.048	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
4	PDB:7lq1A	0.040	0.069	8.423E-3	950	0.032	0.060	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
5	PDB:5dxhD	0.040	0.067	1.804E-2	981	0.030	0.055	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
6	PDB:6pxuB	0.044	0.142	2.447E-2	532	0.008	0.026	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
7	PDB:4atuI	0.040	0.579	2.574E-2	106	0.012	0.208	4atuI.pdb.gz	Molecular Basis for Specific Regulation of Neuronal Kinesin- 3 Motors by Doublecortin Family Proteins.
8	PDB:4d0tA	0.039	0.124	3.318E-2	496	0.011	0.038	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
9	PDB:4yknA	0.042	0.057	3.318E-2	1205	0.012	0.018	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
10	PDB:4qd2B	0.041	0.369	4.981E-2	143	0.008	0.098	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
11	PDB:5itdA	0.036	0.061	5.513E-2	995	0.026	0.047	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
12	PDB:6pyuA	0.040	0.067	5.800E-2	930	0.026	0.049	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
13	AFDB:Q969R2	0.045	0.072	7.962E-2	916	0.058	0.114	Q969R2.pdb.gz	OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 PE=1 SV=2
14	AFDB:D1MYR8	0.035	0.060	1.794E-1	1007	0.022	0.040	D1MYR8.pdb.gz	D1MYR8_9HYPO Guanine-nucleotide exchange factor Cdc24 OS=Epichloe festucae OX=35717 GN=Cdc24 PE=1 SV=1
15	AFDB:Q8I492	0.036	0.043	2.089E-1	1434	0.039	0.048	Q8I492.pdb.gz	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
16	AFDB:A0JC82	0.034	0.102	2.693E-1	519	0.016	0.056	A0JC82.pdb.gz	A0JC82_9HYPO NADPH oxidase regulator NoxR OS=Epichloe festucae OX=35717 GN=noxR PE=1 SV=1
17	AFDB:O45818	0.036	0.059	2.693E-1	1070	0.015	0.025	O45818.pdb.gz	DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans OX=6239 GN=dkf-2 PE=1 SV=4
18	AFDB:F6NN15	0.034	0.039	3.136E-1	1384	0.094	0.121	F6NN15.pdb.gz	F6NN15_DANRE LIM domain 7b OS=Danio rerio OX=7955 GN=DKEY-180K21.1 PE=4 SV=2
19	AFDB:O43491	0.040	0.056	3.136E-1	1005	0.076	0.135	O43491.pdb.gz	E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
20	AFDB:Q4GZE3	0.040	0.057	3.300E-1	1215	0.029	0.042	Q4GZE3.pdb.gz	Q4GZE3_TRYB2 Metal-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.750 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0R2J8	0.0	3714	1783	1.000	1.000	DCDC1_HUMAN Doublecortin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DCDC1 PE=1 SV=1
2	Q54EU5	0.006	43.5	488	0.014	0.051	Q54EU5_DICDI BTB/POZ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=kctd9 PE=4 SV=1
3	A2A123	0.77	37.0	725	0.010	0.023	A2A123_DANRE Dclk2 protein OS=Danio rerio OX=7955 GN=dclk2 PE=1 SV=1
4	A2A124	0.79	37.0	722	0.010	0.024	A2A124_DANRE Doublecortin like protein kinase_4 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
5	A2A121	0.85	37.0	810	0.010	0.021	A2A121_DANRE Doublecortin like protein kinase_1 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
6	A2A122	0.85	37.0	791	0.010	0.021	A2A122_DANRE Doublecortin like protein kinase_2 OS=Danio rerio OX=7955 GN=cb572 PE=1 SV=1
7	Q8IWT0	1.5	34.7	167	0.011	0.120	ARCH_HUMAN Protein archease OS=Homo sapiens OX=9606 GN=ZBTB8OS PE=1 SV=2
8	Q69Z08	2.1	35.4	450	0.012	0.047	RPI1_CAEEL Protein rpi-1 OS=Caenorhabditis elegans OX=6239 GN=rpi-1 PE=2 SV=1
9	P97588	2.7	35.0	468	0.012	0.045	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
10	P77181	3.3	33.9	196	0.015	0.133	PAAY_ECOLI Phenylacetic acid degradation protein PaaY OS=Escherichia coli (strain K12) OX=83333 GN=paaY PE=3 SV=1
11	Q15797	3.7	34.7	465	0.012	0.045	SMAD1_HUMAN Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1
12	P70340	3.8	34.7	465	0.012	0.045	SMAD1_MOUSE Mothers against decapentaplegic homolog 1 OS=Mus musculus OX=10090 GN=Smad1 PE=1 SV=2
13	A8MYV0	4.3	34.3	364	0.010	0.049	DCD2C_HUMAN Doublecortin domain-containing protein 2C OS=Homo sapiens OX=9606 GN=DCDC2C PE=1 SV=4
14	Q9W6N2	6.0	33.5	299	0.011	0.067	Q9W6N2_CHICK Smad1 protein (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
15	Q95QC4	6.1	34.3	802	0.015	0.034	DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans OX=6239 GN=zyg-8 PE=1 SV=1
16	O15075	7.5	33.9	740	0.008	0.019	DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1 PE=1 SV=2
17	Q5QJC4	7.6	33.9	972	0.015	0.028	DCR1A_CHICK DNA cross-link repair 1A protein OS=Gallus gallus OX=9031 GN=DCLRE1A PE=1 SV=1
18	Q9W6N3	7.7	33.5	406	0.011	0.049	Q9W6N3_CHICK Mothers against decapentaplegic homolog (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q56IA0	7.9	33.5	465	0.011	0.043	Q56IA0_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD1 PE=1 SV=1
20	Q9JLM8	8.2	33.5	756	0.008	0.019	DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus OX=10090 GN=Dclk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03607 DCX	1.9e-13	61.5	Doublecortin
2	PF05167 DUF711	9.6e+02	10.0	Uncharacterised ACR (DUF711)
3	PF00652 Ricin_B_lectin	3.6e-05	35.4	Ricin-type beta-trefoil lectin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005578347.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005578366.1	0.590	DPH4-like protein
2	9541.XP_005578382.1	0.590	Metallophosphoesterase MPPED2 isoform X1
3	9541.XP_005578377.1	0.586	Elongator complex protein 4 isoform X1
4	9541.XP_005578368.1	0.573	Mitochondrial inner membrane protease subunit 1 isoform X1
5	9541.XP_005544169.1	0.529	LOW QUALITY PROTEIN: doublecortin domain-containing protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.940	regulation of cellular process
GO:0051302	0.810	regulation of cell division
GO:0009987	0.733	cellular process
GO:0032465	0.628	regulation of cytokinesis
GO:1902412	0.615	regulation of mitotic cytokinesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090543	0.998	Flemming body
GO:0072686	0.997	mitotic spindle
GO:0005737	0.925	cytoplasm
GO:0043227	0.837	membrane-bounded organelle
GO:0043231	0.725	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]