StarFunc result for job id O00110

User Input

>input (214 residues)
MPRAFLVRSRRPQPPNWGHLPDQLRGDAYIPGGPLTVPGGKGQERRSVTIWLFSSDCSSL
GGPPAQQSSSVRDPWTAQPTQGNLTSAPRGPGTLGCPLCPKAFPLQRMLTRHLKCHSPVR
RHLCRCCGKGFHDAFDLKRHMRTHTGIRPFRCSACGKAFTQRCSLEAHLAKVHGQPASYA
YRERREKLHVCEDCGFTSSRPDTYAQHRALHRAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7E2L3	0.402	0.342	8.043E-19	253	0.486	0.411	A7E2L3.pdb.gz	A7E2L3_DANRE Uncharacterized protein LOC100124596 OS=Danio rerio OX=7955 GN=zgc:171929 PE=2 SV=1
2	AFDB:O14753	0.392	0.317	4.952E-18	267	0.477	0.382	O14753.pdb.gz	OVOL1_HUMAN Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3
3	AFDB:F8W4G4	0.397	0.270	1.493E-17	319	0.523	0.351	F8W4G4.pdb.gz	F8W4G4_DANRE Ovo-like zinc finger 1a OS=Danio rerio OX=7955 GN=ovol1 PE=4 SV=1
4	AFDB:G5EDU6	0.398	0.306	3.704E-17	280	0.397	0.304	G5EDU6.pdb.gz	OVOLH_CAEEL Transcription factor ovo-like homolog lin-48 OS=Caenorhabditis elegans OX=6239 GN=lin-48 PE=1 SV=1
5	AFDB:Q8CIV7	0.385	0.303	5.467E-17	274	0.523	0.409	Q8CIV7.pdb.gz	OVOL2_MOUSE Transcription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=1 SV=2
6	AFDB:Q9BRP0	0.401	0.315	7.088E-17	275	0.500	0.389	Q9BRP0.pdb.gz	OVOL2_HUMAN Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2 PE=1 SV=1
7	AFDB:P51521	0.393	0.066	5.320E-14	1351	0.393	0.062	P51521.pdb.gz	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
8	AFDB:Q96H86	0.340	0.188	2.976E-12	408	0.262	0.137	Q96H86.pdb.gz	ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens OX=9606 GN=ZNF764 PE=1 SV=2
9	AFDB:Q99MD8	0.370	0.136	1.413E-11	610	0.280	0.098	Q99MD8.pdb.gz	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
10	AFDB:Q9VDQ4	0.373	0.191	1.508E-11	439	0.257	0.125	Q9VDQ4.pdb.gz	Q9VDQ4_DROME Trade embargo OS=Drosophila melanogaster OX=7227 GN=trem PE=1 SV=2
11	PDB:3w5kB	0.174	0.269	8.713E-5	110	0.173	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.059	0.181	1.623E-1	62	0.075	0.258	6ydhA.pdb.gz
13	PDB:7o4iW	0.097	0.071	1.382	312	0.056	0.038	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:7uhyC	0.091	0.045	1.679	578	0.075	0.028	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7pmkQ	0.076	0.031	1.912	766	0.084	0.023	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	PDB:7qhsG	0.081	0.038	2.177	756	0.084	0.024	7qhsG.pdb.gz	Mechanism of replication origin melting nucleated by CMG helicase assembly.
17	PDB:5apny	0.113	0.115	2.323	211	0.079	0.081	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:6t9lN	0.116	0.264	2.323	82	0.047	0.122	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
19	PDB:5dkaA	0.118	0.226	3.213	96	0.061	0.135	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:5vvrJ	0.080	0.230	3.429	70	0.037	0.114	5vvrJ.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CIV7	6.16e-57	183	274	0.505	0.394	OVOL2_MOUSE Transcription factor Ovo-like 2 OS=Mus musculus OX=10090 GN=Ovol2 PE=1 SV=2
2	F8W4G4	1.50e-56	183	319	0.514	0.345	F8W4G4_DANRE Ovo-like zinc finger 1a OS=Danio rerio OX=7955 GN=ovol1 PE=4 SV=1
3	A7E2L3	4.62e-56	180	253	0.393	0.332	A7E2L3_DANRE Uncharacterized protein LOC100124596 OS=Danio rerio OX=7955 GN=zgc:171929 PE=2 SV=1
4	Q9WTJ2	7.41e-56	180	267	0.481	0.386	OVOL1_MOUSE Putative transcription factor Ovo-like 1 OS=Mus musculus OX=10090 GN=Ovol1 PE=2 SV=1
5	Q9BRP0	1.60e-55	179	275	0.481	0.375	OVOL2_HUMAN Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2 PE=1 SV=1
6	O14753	1.96e-55	179	267	0.491	0.393	OVOL1_HUMAN Putative transcription factor Ovo-like 1 OS=Homo sapiens OX=9606 GN=OVOL1 PE=1 SV=3
7	A9JSU5	5.03e-50	165	256	0.336	0.281	A9JSU5_DANRE Transcription factor Ovo-like 1 OS=Danio rerio OX=7955 GN=ovol1 PE=2 SV=1
8	G5EDU6	5.67e-49	163	280	0.327	0.250	OVOLH_CAEEL Transcription factor ovo-like homolog lin-48 OS=Caenorhabditis elegans OX=6239 GN=lin-48 PE=1 SV=1
9	P51521	7.43e-44	158	1351	0.313	0.050	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
10	Q9VDQ4	1.08e-16	79.7	439	0.201	0.098	Q9VDQ4_DROME Trade embargo OS=Drosophila melanogaster OX=7227 GN=trem PE=1 SV=2
11	Q96H86	1.41e-16	79.3	408	0.248	0.130	ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens OX=9606 GN=ZNF764 PE=1 SV=2
12	A0A0R4YI50	3.69e-16	78.6	698	0.248	0.076	A0A0R4YI50_DROME Earmuff, isoform D OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
13	Q9NX65	4.06e-16	78.6	697	0.201	0.062	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
14	Q9VQ56	4.34e-16	78.6	611	0.252	0.088	ERM_DROME Fez family zinc finger protein erm OS=Drosophila melanogaster OX=7227 GN=erm PE=1 SV=2
15	M9PB02	4.35e-16	78.6	654	0.252	0.083	M9PB02_DROME Earmuff, isoform C OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
16	M9PBS1	4.54e-16	78.2	603	0.252	0.090	M9PBS1_DROME Earmuff, isoform B OS=Drosophila melanogaster OX=7227 GN=erm PE=4 SV=1
17	Q96JL9	8.83e-16	77.4	665	0.206	0.066	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
18	Q9NPC7	8.95e-16	77.4	610	0.224	0.079	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
19	Q99MD8	9.12e-16	77.4	610	0.229	0.080	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
20	O75123	9.58e-16	77.4	536	0.196	0.078	ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens OX=9606 GN=ZNF623 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20026 DUF6434	3.4e+02	12.7	Domain of unknown function (DUF6434)
2	PF01363 FYVE	2.6	19.6	FYVE zinc finger
3	PF00096 zf-C2H2	9.1e-10	49.6	Zinc finger, C2H2 type
4	PF18868 zf-C2H2_3rep	5.1e+02	12.8	Zinc finger C2H2-type, 3 repeats
5	PF13894 zf-C2H2_4	3.5e-06	38.4	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	2.5e+02	13.1	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	22	16.7	Zinc-finger double-stranded RNA-binding
8	PF13465 zf-H2C2_2	3.5e-10	51.0	Zinc-finger double domain
9	PF13909 zf-H2C2_5	1.9e+02	13.2	C2H2-type zinc-finger domain
10	PF12874 zf-met	8.6e+02	11.8	Zinc-finger of C2H2 type
11	PF18387 zf_C2H2_ZHX	4.3e+02	12.1	Zinc-fingers and homeoboxes C2H2 finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342162	0.630	Transmembrane protein 221
2	9606.ENSP00000385494	0.586	Transmembrane protein 211
3	9606.ENSP00000415030	0.576	Transmembrane protein 171
4	9606.ENSP00000315106	0.557	Integral membrane protein GPR137C
5	9606.ENSP00000316532	0.557	Transmembrane protein 132E
6	9606.ENSP00000334072	0.557	Transmembrane protein 212
7	9606.ENSP00000292907	0.546	Cytochrome c oxidase subunit 7A1, mitochondrial
8	9606.ENSP00000301175	0.538	Hydroxyproline dehydrogenase
9	9606.ENSP00000420919	0.517	Transmembrane protein 150C
10	9606.ENSP00000311528	0.504	Probable G-protein coupled receptor 162

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0043565	0.988	sequence-specific DNA binding
GO:0003690	0.987	double-stranded DNA binding
GO:1990837	0.934	sequence-specific double-stranded DNA binding
GO:0001067	0.632	transcription regulatory region nucleic acid binding
GO:0000976	0.622	transcription cis-regulatory region binding
GO:0003700	0.423	DNA-binding transcription factor activity
GO:0000977	0.332	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.301	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.968	regulation of biological process
GO:0009987	0.967	cellular process
GO:0060255	0.942	regulation of macromolecule metabolic process
GO:0050794	0.926	regulation of cellular process
GO:0010468	0.701	regulation of gene expression
GO:0050896	0.558	response to stimulus
GO:0009889	0.540	regulation of biosynthetic process
GO:0031326	0.534	regulation of cellular biosynthetic process
GO:0080090	0.532	regulation of primary metabolic process
GO:0010556	0.516	regulation of macromolecule biosynthetic process
GO:0048519	0.354	negative regulation of biological process
GO:0051252	0.317	regulation of RNA metabolic process
GO:1903506	0.309	regulation of nucleic acid-templated transcription
GO:0006355	0.302	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.987	nuclear lumen
GO:0005654	0.935	nucleoplasm
GO:0016020	0.864	membrane
GO:0005737	0.716	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]