StarFunc result for job id O00116

User Input

>input (658 residues)
MAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKA
RRAASAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRYPL
SGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEAD
DRVFRAHGHCLHEIFLLREGMFERIPDIVLWPTCHDDVVKIVNLACKYNLCIIPIGGGTS
VSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTGH
EPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQGPRMSTGPDI
HHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRL
MDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQH
EKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVDL
CRNVKERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEA
AAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5adzC	0.843	0.996	0.000	557	0.796	0.941	5adzC.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.
2	AFDB:A0A2R8YEL0	0.830	0.808	0.000	676	0.939	0.914	A0A2R8YEL0.pdb.gz	A0A2R8YEL0_HUMAN Alkylglycerone-phosphate synthase OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=2
3	AFDB:P97275	0.890	0.890	0.000	658	0.924	0.924	P97275.pdb.gz	ADAS_CAVPO Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Cavia porcellus OX=10141 GN=AGPS PE=1 SV=1
4	PDB:5adzA	0.838	0.974	3.483E-104	566	0.812	0.943	5adzA.pdb.gz	Discovery of Inhibitors for the Ether Lipid-Generating Enzyme Agps as Anti-Cancer Agents.
5	AFDB:Q9V778	0.859	0.896	3.615E-82	631	0.491	0.512	Q9V778.pdb.gz	ADAS_DROME Alkyldihydroxyacetonephosphate synthase OS=Drosophila melanogaster OX=7227 GN=ADPS PE=2 SV=1
6	AFDB:O96759	0.808	0.869	1.193E-58	611	0.277	0.298	O96759.pdb.gz	ADAS_DICDI Alkyldihydroxyacetonephosphate synthase OS=Dictyostelium discoideum OX=44689 GN=eapA PE=1 SV=1
7	AFDB:Q7YWB6	0.818	0.866	4.131E-56	621	0.277	0.293	Q7YWB6.pdb.gz	Q7YWB6_LEIMA Alkylglycerone-phosphate synthase OS=Leishmania major OX=5664 GN=ADS1 PE=3 SV=1
8	AFDB:Q585R0	0.800	0.858	1.158E-54	613	0.263	0.282	Q585R0.pdb.gz	Q585R0_TRYB2 Alkylglycerone-phosphate synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.170 PE=3 SV=1
9	PDB:2uuuA	0.739	0.878	1.481E-52	550	0.266	0.318	2uuuA.pdb.gz	The Crucial Step in Ether Phospholipid Biosynthesis: Structural Basis of a Noncanonical Reaction Associated with a Peroxisomal Disorder.
10	AFDB:O05784	0.720	0.891	1.172E-41	527	0.214	0.268	O05784.pdb.gz	O05784_MYCTU Possible alkyldihydroxyacetonephosphate synthase AgpS (Alkyl-DHAP synthase) (Alkylglycerone-phosphate synthase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=agpS PE=1 SV=1
11	AFDB:Q94AX4	0.609	0.702	1.510E-31	567	0.182	0.212	Q94AX4.pdb.gz	DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
12	AFDB:A0A0G2K1W9	0.610	0.818	5.561E-30	482	0.164	0.224	A0A0G2K1W9.pdb.gz	A0A0G2K1W9_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=3 SV=2
13	AFDB:P32891	0.604	0.672	6.157E-29	587	0.161	0.181	P32891.pdb.gz	DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
14	PDB:6lpnB	0.587	0.807	1.747E-23	467	0.143	0.201	6lpnB.pdb.gz	Structure, substrate specificity, and catalytic mechanism of human D-2-HGDH and insights into pathogenicity of disease-associated mutations.
15	PDB:2exrA	0.491	0.636	1.131E-16	491	0.105	0.141	2exrA.pdb.gz	Crystal structure of Arabidopsis thaliana cytokinin dehydrogenase.
16	PDB:3w8wB	0.509	0.691	1.954E-16	461	0.135	0.193	3w8wB.pdb.gz	Flavin-mediated dual oxidation controls an enzymatic Favorskii-type rearrangement.
17	PDB:4pfdB	0.430	0.659	1.323E-15	410	0.112	0.180	4pfdB.pdb.gz	Crystal structure of M. tuberculosis in complex with a cBT
18	PDB:6hfwA	0.433	0.640	3.171E-15	429	0.122	0.186	6hfwA.pdb.gz	Novel insight into the reaction of nitro, nitroso and hydroxylamino benzothiazinones and of benzoxacinones with Mycobacterium tuberculosis DprE1.
19	PDB:4dnsA	0.434	0.564	3.945E-15	486	0.109	0.148	4dnsA.pdb.gz	Various cross-reactivity of the grass pollen group 4 allergens: crystallographic study of the Bermuda grass isoallergen Cyn d 4.
20	PDB:4p8tA	0.446	0.620	6.109E-15	456	0.125	0.180	4p8tA.pdb.gz	2-Carboxyquinoxalines Kill Mycobacterium tuberculosis through Noncovalent Inhibition of DprE1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GWA2	0.0	1293	629	0.939	0.983	A0A1B0GWA2_HUMAN Alkylglycerone-phosphate synthase OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=2
2	A0A2R8YEL0	0.0	1290	676	0.939	0.914	A0A2R8YEL0_HUMAN Alkylglycerone-phosphate synthase OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=2
3	B7Z3Q4	0.0	1194	568	0.863	1.000	B7Z3Q4_HUMAN Alkylglycerone-phosphate synthase OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1
4	O00116	0.0	1377	658	1.000	1.000	ADAS_HUMAN Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1
5	P97275	0.0	1239	658	0.918	0.918	ADAS_CAVPO Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Cavia porcellus OX=10141 GN=AGPS PE=1 SV=1
6	Q8C0I1	0.0	1214	645	0.891	0.909	ADAS_MOUSE Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Mus musculus OX=10090 GN=Agps PE=1 SV=1
7	Q9EQR2	0.0	1190	644	0.883	0.902	ADAS_RAT Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Rattus norvegicus OX=10116 GN=Agps PE=1 SV=1
8	Q9V778	0.0	684	631	0.486	0.507	ADAS_DROME Alkyldihydroxyacetonephosphate synthase OS=Drosophila melanogaster OX=7227 GN=ADPS PE=2 SV=1
9	O96759	3.97e-101	323	611	0.293	0.316	ADAS_DICDI Alkyldihydroxyacetonephosphate synthase OS=Dictyostelium discoideum OX=44689 GN=eapA PE=1 SV=1
10	Q7YWB6	7.15e-89	291	621	0.280	0.296	Q7YWB6_LEIMA Alkylglycerone-phosphate synthase OS=Leishmania major OX=5664 GN=ADS1 PE=3 SV=1
11	Q585R0	2.96e-84	279	613	0.267	0.287	Q585R0_TRYB2 Alkylglycerone-phosphate synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.170 PE=3 SV=1
12	O05784	8.72e-48	178	527	0.222	0.277	O05784_MYCTU Possible alkyldihydroxyacetonephosphate synthase AgpS (Alkyl-DHAP synthase) (Alkylglycerone-phosphate synthase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=agpS PE=1 SV=1
13	Q94AX4	3.82e-27	118	567	0.185	0.215	DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
14	P32891	1.96e-24	110	587	0.170	0.191	DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
15	A0A0G2K1W9	7.64e-22	101	484	0.193	0.262	A0A0G2K1W9_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=3 SV=2
16	Q7TNG8	1.85e-21	100	484	0.182	0.248	LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ldhd PE=1 SV=1
17	Q86WU2	9.74e-21	98.2	507	0.166	0.215	LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=LDHD PE=1 SV=1
18	A0A8I5Y6D8	3.67e-19	93.2	466	0.120	0.170	A0A8I5Y6D8_RAT Lactate dehydrogenase D OS=Rattus norvegicus OX=10116 GN=Ldhd PE=1 SV=1
19	Q7TPJ4	4.83e-19	93.2	501	0.120	0.158	Q7TPJ4_RAT Ac2-202 OS=Rattus norvegicus OX=10116 GN=Ldhd PE=1 SV=1
20	P9WIT1	1.58e-18	91.3	459	0.100	0.144	Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2280 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08031 BBE	4.4e+02	12.4	Berberine and berberine like
2	PF02913 FAD-oxidase_C	6.2e-56	201.4	FAD linked oxidases, C-terminal domain
3	PF01565 FAD_binding_4	3.8e-36	135.3	FAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355607	0.995	Glyceronephosphate O-acyltransferase
2	9606.ENSP00000346874	0.989	Fatty acyl-CoA reductase 1
3	9606.ENSP00000443291	0.982	Fatty acyl-CoA reductase 2
4	9606.ENSP00000333664	0.963	3-ketoacyl-CoA thiolase, peroxisomal
5	9606.ENSP00000263038	0.962	Phytanoyl-CoA dioxygenase, peroxisomal
6	9606.ENSP00000287078	0.959	Peroxisomal leader peptide-processing protease
7	9606.ENSP00000391601	0.956	Peroxisomal targeting signal 1 receptor
8	9606.ENSP00000315680	0.937	Peroxisomal targeting signal 2 receptor
9	9606.ENSP00000359233	0.859	ATP-binding cassette sub-family D member 3
10	9606.ENSP00000349016	0.844	Peroxisomal membrane protein PEX14
11	9606.ENSP00000360569	0.836	Non-specific lipid-transfer protein
12	9606.ENSP00000313869	0.815	Golgi reassembly-stacking protein 1
13	9606.ENSP00000295030	0.806	Peroxisomal membrane protein PEX13
14	9606.ENSP00000482609	0.794	Peroxisome assembly protein 12
15	9606.ENSP00000218104	0.772	ATP-binding cassette sub-family D member 1
16	9606.ENSP00000288774	0.751	Peroxisome biogenesis factor 10
17	9606.ENSP00000378887	0.751	Dehydrogenase/reductase SDR family member 7B
18	9606.ENSP00000391504	0.741	Coiled-coil domain containing 173
19	9606.ENSP00000379568	0.729	Acyl-CoA-binding domain-containing protein 5
20	9606.ENSP00000393675	0.724	Mitoguardin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0008609	1.000	alkylglycerone-phosphate synthase activity
GO:0043168	0.988	anion binding
GO:0000166	0.985	nucleotide binding
GO:0050660	0.979	flavin adenine dinucleotide binding
GO:0071949	0.951	FAD binding
GO:0005515	0.864	protein binding
GO:0016491	0.588	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0008610	0.992	lipid biosynthetic process
GO:0044237	0.978	cellular metabolic process
GO:0044281	0.914	small molecule metabolic process
GO:0044255	0.867	cellular lipid metabolic process
GO:0044249	0.555	cellular biosynthetic process
GO:0018904	0.322	ether metabolic process
GO:1901503	0.306	ether biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	0.999	peroxisome
GO:0070013	0.998	intracellular organelle lumen
GO:0005829	0.934	cytosol
GO:0005782	0.934	peroxisomal matrix
GO:0016020	0.913	membrane
GO:0005739	0.871	mitochondrion
GO:0031090	0.850	organelle membrane
GO:0005778	0.841	peroxisomal membrane
GO:0031981	0.408	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:36171	1.000	a 1-acylglycerone 3-phosphate + a long chain fatty alcohol = 1-O-alkylglycerone 3-phosphate + a long-chain fatty acid + H(+)
EC:2.5.1.26	1.000	alkylglycerone-phosphate synthase.
EC:1.-.-.-	0.588	Oxidoreductases.

[back to server]