StarFunc result for job id O00142

User Input

>input (265 residues)
MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIA
SGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDR
HTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIV
YLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHH
MERMLELFEQNRDRILTPENRKHCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00142	1.000	1.000	1.781E-49	265	1.000	1.000	O00142.pdb.gz	KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TK2 PE=1 SV=4
2	AFDB:D3ZGQ2	0.879	0.864	2.005E-41	270	0.804	0.789	D3ZGQ2.pdb.gz	D3ZGQ2_RAT Thymidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Tk2 PE=3 SV=1
3	AFDB:Q9XZT6	0.775	0.820	4.190E-23	250	0.366	0.388	Q9XZT6.pdb.gz	DNK_DROME Deoxynucleoside kinase OS=Drosophila melanogaster OX=7227 GN=dnk PE=1 SV=1
4	PDB:2vp4D	0.699	0.923	8.382E-22	199	0.355	0.472	2vp4D.pdb.gz	Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
5	AFDB:D6RFG8	0.763	0.641	2.771E-20	317	0.298	0.249	D6RFG8.pdb.gz	D6RFG8_HUMAN Deoxycytidine kinase OS=Homo sapiens OX=9606 GN=DCK PE=1 SV=1
6	AFDB:Q5ZJM7	0.764	0.764	3.273E-20	265	0.313	0.313	Q5ZJM7.pdb.gz	DCK2_CHICK Deoxycytidine kinase 2 OS=Gallus gallus OX=9031 GN=DCK2 PE=1 SV=1
7	AFDB:A0A1L8HV70	0.719	0.719	5.701E-20	265	0.309	0.309	A0A1L8HV70.pdb.gz	DCK1_XENLA Deoxycytidine kinase 1 OS=Xenopus laevis OX=8355 GN=dck.1.L PE=1 SV=1
8	AFDB:P48769	0.756	0.770	2.697E-19	260	0.298	0.304	P48769.pdb.gz	DCK_RAT Deoxycytidine kinase OS=Rattus norvegicus OX=10116 GN=Dck PE=1 SV=1
9	AFDB:Q5ZMF3	0.749	0.772	2.697E-19	257	0.298	0.307	Q5ZMF3.pdb.gz	DCK_CHICK Deoxycytidine kinase OS=Gallus gallus OX=9031 GN=DCK PE=1 SV=1
10	AFDB:D3ZDE4	0.752	0.719	3.014E-19	278	0.291	0.277	D3ZDE4.pdb.gz	D3ZDE4_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=3 SV=1
11	AFDB:Q6DD33	0.766	0.769	7.743E-19	264	0.294	0.295	Q6DD33.pdb.gz	DCK2_XENLA Deoxycytidine kinase 2 OS=Xenopus laevis OX=8355 GN=dck.2 PE=1 SV=1
12	PDB:2a2zB	0.734	0.874	5.104E-18	221	0.294	0.353	2a2zB.pdb.gz	Structural basis for the preference of UTP over ATP in human deoxycytidine kinase: illuminating the role of main-chain reorganization.
13	PDB:2no0A	0.699	0.762	8.412E-18	242	0.291	0.318	2no0A.pdb.gz	Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.
14	PDB:4tmkA	0.470	0.574	4.015E-7	210	0.140	0.176	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.
15	PDB:7qsdO	0.568	0.479	5.601E-7	320	0.162	0.134	7qsdO.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
16	PDB:7ak5O	0.592	0.499	1.899E-6	320	0.162	0.134	7ak5O.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
17	PDB:3tmkA	0.474	0.561	2.650E-6	216	0.132	0.162	3tmkA.pdb.gz	Crystal structure of yeast thymidylate kinase complexed with the bisubstrate inhibitor P1-(5'-adenosyl) P5-(5'-thymidyl) pentaphosphate (TP5A) at 2.0 A resolution: implications for catalysis and AZT activation.
18	PDB:2c95A	0.451	0.586	9.498E-6	195	0.143	0.195	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
19	PDB:5nrnB	0.484	0.586	1.749E-5	211	0.143	0.180	5nrnB.pdb.gz	Mtb TMK crystal structure in complex with compound LS3080
20	PDB:1e2fA	0.491	0.594	2.184E-5	210	0.136	0.171	1e2fA.pdb.gz	Insights Into the Phosphoryltransfer Mechanism of Human Thymidylate Kinase Gained from Crystal Structures of Enzyme Complexes Along the Reaction Coordinate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00142	0.0	550	265	1.000	1.000	KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=TK2 PE=1 SV=4
2	Q9R088	2.97e-148	417	270	0.811	0.796	KITM_MOUSE Thymidine kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Tk2 PE=1 SV=2
3	D3ZGQ2	2.46e-142	402	270	0.804	0.789	D3ZGQ2_RAT Thymidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Tk2 PE=3 SV=1
4	Q9XZT6	3.13e-61	195	250	0.358	0.380	DNK_DROME Deoxynucleoside kinase OS=Drosophila melanogaster OX=7227 GN=dnk PE=1 SV=1
5	A0A8I5ZTL4	1.51e-47	156	136	0.366	0.713	A0A8I5ZTL4_RAT Thymidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Tk2 PE=4 SV=1
6	Q5ZJM7	1.94e-40	142	265	0.294	0.294	DCK2_CHICK Deoxycytidine kinase 2 OS=Gallus gallus OX=9031 GN=DCK2 PE=1 SV=1
7	P43346	1.05e-39	140	260	0.309	0.315	DCK_MOUSE Deoxycytidine kinase OS=Mus musculus OX=10090 GN=Dck PE=1 SV=1
8	Q5ZMF3	3.61e-39	139	257	0.321	0.331	DCK_CHICK Deoxycytidine kinase OS=Gallus gallus OX=9031 GN=DCK PE=1 SV=1
9	F5CTF3	1.27e-38	137	260	0.302	0.308	F5CTF3_HUMAN Deoxynucleoside kinase OS=Homo sapiens OX=9606 PE=2 SV=1
10	P27707	1.27e-38	137	260	0.302	0.308	DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens OX=9606 GN=DCK PE=1 SV=1
11	P48769	2.74e-38	136	260	0.306	0.312	DCK_RAT Deoxycytidine kinase OS=Rattus norvegicus OX=10116 GN=Dck PE=1 SV=1
12	D6RFG8	5.88e-38	137	317	0.302	0.252	D6RFG8_HUMAN Deoxycytidine kinase OS=Homo sapiens OX=9606 GN=DCK PE=1 SV=1
13	A0A1L8HV70	2.90e-36	131	265	0.294	0.294	DCK1_XENLA Deoxycytidine kinase 1 OS=Xenopus laevis OX=8355 GN=dck.1.L PE=1 SV=1
14	Q6GPW6	6.79e-36	130	265	0.268	0.268	DGUOK_XENLA Deoxyguanosine kinase, mitochondrial OS=Xenopus laevis OX=8355 GN=dguok PE=1 SV=1
15	Q6DD33	1.74e-35	129	264	0.272	0.273	DCK2_XENLA Deoxycytidine kinase 2 OS=Xenopus laevis OX=8355 GN=dck.2 PE=1 SV=1
16	D3ZDE4	4.57e-34	126	278	0.279	0.266	D3ZDE4_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=3 SV=1
17	A0A8I5ZV32	1.21e-33	125	309	0.279	0.239	A0A8I5ZV32_RAT Deoxyguanosine kinase OS=Rattus norvegicus OX=10116 GN=Dguok PE=1 SV=1
18	Q16854	2.75e-33	124	277	0.298	0.285	DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens OX=9606 GN=DGUOK PE=1 SV=2
19	Q9QX60	5.47e-33	123	277	0.264	0.253	DGUOK_MOUSE Deoxyguanosine kinase, mitochondrial OS=Mus musculus OX=10090 GN=Dguok PE=1 SV=3
20	Q501D4	4.40e-31	123	580	0.260	0.119	Q501D4_ARATH At1g72040 OS=Arabidopsis thaliana OX=3702 GN=DNK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	1.6e+02	14.1	AAA domain
2	PF13238 AAA_18	0.038	26.0	AAA domain
3	PF13401 AAA_22	2.7e+02	13.2	AAA domain
4	PF13671 AAA_33	0.00095	30.8	AAA domain
5	PF01712 dNK	2.4e-65	231.8	Deoxynucleoside kinase
6	PF02223 Thymidylate_kin	34	15.6	Thymidylate kinase
7	PF06414 Zeta_toxin	6.2e+02	11.1	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299697

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370376	0.979	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
2	9606.ENSP00000379038	0.964	Thymidine phosphorylase
3	9606.ENSP00000315644	0.960	Thymidylate synthase
4	9606.ENSP00000330032	0.959	Uridine phosphorylase 1
5	9606.ENSP00000349576	0.956	Deoxycytidylate deaminase
6	9606.ENSP00000304802	0.951	Thymidylate kinase
7	9606.ENSP00000474090	0.947	Uridine phosphorylase 2
8	9606.ENSP00000364212	0.942	Cytidine deaminase
9	9606.ENSP00000301634	0.926	Thymidine kinase, cytosolic
10	9606.ENSP00000301825	0.918	Ectonucleoside triphosphate diphosphohydrolase 3
11	9606.ENSP00000360561	0.918	Ectonucleoside triphosphate diphosphohydrolase 8
12	9606.ENSP00000354532	0.911	Purine nucleoside phosphorylase
13	9606.ENSP00000360250	0.903	Ectonucleoside triphosphate diphosphohydrolase 1
14	9606.ENSP00000251810	0.877	Ribonucleoside-diphosphate reductase subunit M2 B
15	9606.ENSP00000373674	0.849	5'(3')-deoxyribonucleotidase, mitochondrial
16	9606.ENSP00000245552	0.846	5'(3')-deoxyribonucleotidase, cytosolic type
17	9606.ENSP00000235628	0.810	Cytosolic 5'-nucleotidase 1A
18	9606.ENSP00000339479	0.809	Cytosolic purine 5'-nucleotidase
19	9606.ENSP00000352904	0.800	Cytosolic 5'-nucleotidase 1B
20	9606.ENSP00000433415	0.800	NT5C1B-RDH14 readthrough

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004137	1.000	deoxycytidine kinase activity
GO:0004797	0.876	thymidine kinase activity
GO:0004138	0.403	deoxyguanosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0044281	0.978	small molecule metabolic process
GO:0006139	0.977	nucleobase-containing compound metabolic process
GO:1901135	0.975	carbohydrate derivative metabolic process
GO:0009116	0.968	nucleoside metabolic process
GO:0072527	0.964	pyrimidine-containing compound metabolic process
GO:1901576	0.540	organic substance biosynthetic process
GO:0034654	0.421	nucleobase-containing compound biosynthetic process
GO:0071840	0.413	cellular component organization or biogenesis
GO:0016043	0.382	cellular component organization
GO:0006753	0.371	nucleoside phosphate metabolic process
GO:0007005	0.347	mitochondrion organization
GO:1901137	0.332	carbohydrate derivative biosynthetic process
GO:0006213	0.306	pyrimidine nucleoside metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0016020	0.881	membrane
GO:0031967	0.791	organelle envelope
GO:0005740	0.568	mitochondrial envelope
GO:0031090	0.545	organelle membrane
GO:0032991	0.535	protein-containing complex
GO:0031966	0.515	mitochondrial membrane
GO:0019866	0.505	organelle inner membrane
GO:0005743	0.504	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20061	1.000	2'-deoxycytidine + a ribonucleoside 5'-triphosphate = a ribonucleoside 5'-diphosphate + dCMP + H(+)
EC:2.7.1.74	1.000	deoxycytidine kinase.
RHEA:19129	0.876	ATP + thymidine = ADP + dTMP + H(+)
EC:2.7.1.21	0.876	thymidine kinase.
RHEA:19201	0.403	2'-deoxyguanosine + ATP = ADP + dGMP + H(+)
EC:2.7.1.113	0.403	deoxyguanosine kinase.

[back to server]