StarFunc result for job id O00144

User Input

>input (591 residues)
MAVAPLRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCAAAAGPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CYRKIAAGRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K4C8	0.726	0.725	6.415E-80	592	0.959	0.958	Q8K4C8.pdb.gz	FZD9_RAT Frizzled-9 OS=Rattus norvegicus OX=10116 GN=Fzd9 PE=2 SV=1
2	AFDB:Q8BKG4	0.614	0.623	5.622E-63	582	0.626	0.636	Q8BKG4.pdb.gz	FZD10_MOUSE Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1
3	AFDB:Q90WM3	0.613	0.625	4.430E-60	580	0.609	0.621	Q90WM3.pdb.gz
4	AFDB:Q9QZH0	0.552	0.605	3.547E-48	538	0.467	0.513	Q9QZH0.pdb.gz	FZD4_RAT Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1
5	AFDB:B0S6S2	0.557	0.571	2.224E-45	576	0.413	0.424	B0S6S2.pdb.gz
6	AFDB:O93274	0.555	0.564	2.392E-44	581	0.416	0.423	O93274.pdb.gz	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
7	AFDB:O75084	0.529	0.544	4.535E-44	574	0.428	0.441	O75084.pdb.gz	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2
8	AFDB:Q9PTT7	0.539	0.550	4.969E-44	579	0.404	0.413	Q9PTT7.pdb.gz
9	AFDB:Q13467	0.528	0.533	6.841E-44	585	0.435	0.439	Q13467.pdb.gz	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
10	AFDB:B3DIG4	0.521	0.520	8.999E-44	592	0.403	0.402	B3DIG4.pdb.gz	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
11	PDB:7evwR	0.491	0.829	1.711E-23	340	0.283	0.491	7evwR.pdb.gz
12	PDB:7e32R	0.323	0.604	8.127E-6	285	0.074	0.154	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:7jvrR	0.364	0.736	3.670E-5	269	0.056	0.123	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
14	PDB:6wwzR	0.346	0.590	1.512E-4	310	0.054	0.103	6wwzR.pdb.gz
15	PDB:7fiiR	0.347	0.358	1.583E-4	570	0.085	0.088	7fiiR.pdb.gz
16	PDB:4xesA	0.361	0.441	1.735E-4	471	0.073	0.091	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
17	PDB:7f6hA	0.341	0.582	1.735E-4	305	0.078	0.151	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
18	PDB:7f1qR	0.355	0.537	1.900E-4	367	0.063	0.101	7f1qR.pdb.gz
19	PDB:7wicR	0.318	0.596	1.900E-4	288	0.074	0.153	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
20	PDB:7durR	0.305	0.453	2.281E-4	371	0.085	0.135	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00144	0.0	1213	591	1.000	1.000	FZD9_HUMAN Frizzled-9 OS=Homo sapiens OX=9606 GN=FZD9 PE=2 SV=1
2	Q61088	0.0	550	537	0.450	0.495	FZD4_MOUSE Frizzled-4 OS=Mus musculus OX=10090 GN=Fzd4 PE=1 SV=1
3	Q8BKG4	0.0	770	582	0.636	0.646	FZD10_MOUSE Frizzled-10 OS=Mus musculus OX=10090 GN=Fzd10 PE=1 SV=1
4	Q8K4C8	0.0	1142	592	0.959	0.958	FZD9_RAT Frizzled-9 OS=Rattus norvegicus OX=10116 GN=Fzd9 PE=2 SV=1
5	Q8TAN2	0.0	1207	591	0.993	0.993	Q8TAN2_HUMAN Frizzled homolog 9 (Drosophila) OS=Homo sapiens OX=9606 GN=FZD9 PE=1 SV=1
6	Q9QZH0	0.0	550	538	0.452	0.496	FZD4_RAT Frizzled-4 OS=Rattus norvegicus OX=10116 GN=Fzd4 PE=2 SV=1
7	Q9R216	0.0	1140	592	0.958	0.956	FZD9_MOUSE Frizzled-9 OS=Mus musculus OX=10090 GN=Fzd9 PE=2 SV=1
8	Q9ULV1	0.0	551	537	0.452	0.497	FZD4_HUMAN Frizzled-4 OS=Homo sapiens OX=9606 GN=FZD4 PE=1 SV=2
9	Q9ULW2	0.0	766	581	0.616	0.627	FZD10_HUMAN Frizzled-10 OS=Homo sapiens OX=9606 GN=FZD10 PE=1 SV=1
10	Q9W6E3	0.0	736	580	0.609	0.621	Q9W6E3_DANRE Frizzled class receptor 10 OS=Danio rerio OX=7955 GN=fk48e04 PE=2 SV=1
11	Q9PWK6	9.45e-163	478	576	0.401	0.411	Q9PWK6_DANRE Frizzled 8b protein OS=Danio rerio OX=7955 GN=ZG06 PE=2 SV=1
12	Q9YI00	1.11e-157	466	579	0.386	0.394	Q9YI00_DANRE Frizzled 8a protein OS=Danio rerio OX=7955 GN=zg05 PE=2 SV=1
13	Q13467	2.29e-157	465	585	0.425	0.429	FZD5_HUMAN Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2
14	O93274	3.82e-157	464	581	0.408	0.415	FZD8_XENLA Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1
15	Q9EQD0	1.10e-156	463	585	0.437	0.441	FZD5_MOUSE Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3
16	Q8CHL0	1.35e-156	463	585	0.423	0.427	FZD5_RAT Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1
17	P58421	5.80e-153	452	559	0.406	0.429	FZD5_XENLA Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1
18	Q90YL7	2.04e-150	446	550	0.398	0.427	Q90YL7_DANRE Frizzled homolog 2 OS=Danio rerio OX=7955 GN=zfz2 PE=2 SV=1
19	B3DIG4	4.01e-150	447	592	0.406	0.405	B3DIG4_DANRE Frizzled class receptor 5 OS=Danio rerio OX=7955 GN=fzd8c PE=2 SV=1
20	O75084	9.50e-149	442	574	0.406	0.418	FZD7_HUMAN Frizzled-7 OS=Homo sapiens OX=9606 GN=FZD7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	0.068	24.0	7 transmembrane receptor (Secretin family)
2	PF05462 Dicty_CAR	0.76	20.5	Slime mold cyclic AMP receptor
3	PF01534 Frizzled	7.5e-127	434.5	Frizzled/Smoothened family membrane region
4	PF01392 Fz	8.3e-28	108.7	Fz domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345785

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265441	0.977	Protein Wnt-2
2	9606.ENSP00000264634	0.971	Protein Wnt-5a
3	9606.ENSP00000261349	0.957	Low-density lipoprotein receptor-related protein 6
4	9606.ENSP00000293549	0.954	Proto-oncogene Wnt-1
5	9606.ENSP00000294304	0.947	Low-density lipoprotein receptor-related protein 5
6	9606.ENSP00000285018	0.931	Protein Wnt-7a
7	9606.ENSP00000380379	0.910	Protein Wnt-5b
8	9606.ENSP00000368169	0.907	Segment polarity protein dishevelled homolog DVL-1
9	9606.ENSP00000290167	0.897	Protein Wnt-4
10	9606.ENSP00000222462	0.892	Protein Wnt-16
11	9606.ENSP00000284523	0.882	Protein Wnt-3a
12	9606.ENSP00000005340	0.880	Segment polarity protein dishevelled homolog DVL-2
13	9606.ENSP00000316054	0.880	Segment polarity protein dishevelled homolog DVL-3
14	9606.ENSP00000478721	0.876	Tyrosine-protein kinase RYK
15	9606.ENSP00000272164	0.869	Protein Wnt-9a
16	9606.ENSP00000358698	0.868	Protein Wnt-2b
17	9606.ENSP00000225512	0.866	Proto-oncogene Wnt-3
18	9606.ENSP00000325526	0.866	Protein Wnt-11
19	9606.ENSP00000164024	0.865	Cadherin EGF LAG seven-pass G-type receptor 3
20	9606.ENSP00000341032	0.864	Protein Wnt-7b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042813	1.000	Wnt receptor activity
GO:0017147	0.974	Wnt-protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048856	0.994	anatomical structure development
GO:0009987	0.991	cellular process
GO:0050896	0.990	response to stimulus
GO:0032501	0.989	multicellular organismal process
GO:0023052	0.980	signaling
GO:0007154	0.980	cell communication
GO:0051716	0.978	cellular response to stimulus
GO:0016055	0.963	Wnt signaling pathway
GO:0048519	0.912	negative regulation of biological process
GO:0048518	0.861	positive regulation of biological process
GO:0048522	0.828	positive regulation of cellular process
GO:0019222	0.824	regulation of metabolic process
GO:0060255	0.770	regulation of macromolecule metabolic process
GO:0007275	0.744	multicellular organism development
GO:0048523	0.731	negative regulation of cellular process
GO:0080090	0.717	regulation of primary metabolic process
GO:0051171	0.712	regulation of nitrogen compound metabolic process
GO:0048731	0.691	system development
GO:0050793	0.656	regulation of developmental process
GO:0051239	0.634	regulation of multicellular organismal process
GO:0031323	0.630	regulation of cellular metabolic process
GO:0009893	0.586	positive regulation of metabolic process
GO:0048583	0.540	regulation of response to stimulus
GO:0023051	0.537	regulation of signaling
GO:0010646	0.537	regulation of cell communication
GO:0009966	0.527	regulation of signal transduction
GO:0010468	0.500	regulation of gene expression
GO:0010604	0.483	positive regulation of macromolecule metabolic process
GO:0042127	0.482	regulation of cell population proliferation
GO:0030154	0.457	cell differentiation
GO:0051173	0.435	positive regulation of nitrogen compound metabolic process
GO:0009889	0.433	regulation of biosynthetic process
GO:0031325	0.433	positive regulation of cellular metabolic process
GO:0010556	0.422	regulation of macromolecule biosynthetic process
GO:0031326	0.421	regulation of cellular biosynthetic process
GO:0019219	0.418	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.392	regulation of RNA metabolic process
GO:0060070	0.386	canonical Wnt signaling pathway
GO:0065009	0.375	regulation of molecular function
GO:0006355	0.366	regulation of DNA-templated transcription
GO:0048513	0.362	animal organ development
GO:0007399	0.316	nervous system development
GO:0071840	0.311	cellular component organization or biogenesis
GO:0048584	0.311	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.973	intracellular anatomical structure
GO:0005737	0.935	cytoplasm
GO:0043226	0.699	organelle
GO:0043227	0.691	membrane-bounded organelle
GO:0043229	0.653	intracellular organelle
GO:0043231	0.606	intracellular membrane-bounded organelle
GO:0031982	0.326	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]