StarFunc result for job id O00154

User Input

>input (380 residues)
MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIM
RPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGE
VAHVSAEITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWYVPLSLKNVDKVLEVPPVV
YSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCT
LHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTS
NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEE
GKGRYLQMKAKRQGHAEPQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00154	1.000	1.000	1.093E-73	380	1.000	1.000	O00154.pdb.gz	BACH_HUMAN Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7 PE=1 SV=3
2	AFDB:Q64559	0.875	0.873	1.871E-64	381	0.871	0.869	Q64559.pdb.gz	BACH_RAT Cytosolic acyl coenzyme A thioester hydrolase OS=Rattus norvegicus OX=10116 GN=Acot7 PE=1 SV=4
3	AFDB:Q6ZUV0	0.652	0.978	1.250E-38	252	0.579	0.873	Q6ZUV0.pdb.gz	BACHL_HUMAN Putative cytosolic acyl coenzyme A thioester hydrolase-like OS=Homo sapiens OX=9606 GN=ACOT7L PE=5 SV=1
4	AFDB:Q8VHQ9	0.746	0.484	1.246E-26	594	0.197	0.126	Q8VHQ9.pdb.gz	ACO11_MOUSE Acyl-coenzyme A thioesterase 11 OS=Mus musculus OX=10090 GN=Acot11 PE=1 SV=1
5	AFDB:Q8WXI4	0.713	0.455	2.137E-26	607	0.192	0.120	Q8WXI4.pdb.gz	ACO11_HUMAN Acyl-coenzyme A thioesterase 11 OS=Homo sapiens OX=9606 GN=ACOT11 PE=1 SV=1
6	AFDB:Q99NB7	0.706	0.488	5.645E-26	556	0.189	0.129	Q99NB7.pdb.gz	ACO12_RAT Acetyl-coenzyme A thioesterase OS=Rattus norvegicus OX=10116 GN=Acot12 PE=1 SV=1
7	AFDB:Q8WYK0	0.709	0.492	9.175E-26	555	0.182	0.124	Q8WYK0.pdb.gz	ACO12_HUMAN Acetyl-coenzyme A thioesterase OS=Homo sapiens OX=9606 GN=ACOT12 PE=1 SV=1
8	AFDB:Q580L6	0.701	0.722	2.023E-23	368	0.150	0.155	Q580L6.pdb.gz	Q580L6_TRYB2 HotDog ACOT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.470 PE=4 SV=1
9	AFDB:Q9Y305	0.697	0.609	7.251E-21	439	0.182	0.157	Q9Y305.pdb.gz	ACOT9_HUMAN Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT9 PE=1 SV=2
10	AFDB:Q9LK77	0.682	0.597	1.313E-20	438	0.158	0.137	Q9LK77.pdb.gz	Q9LK77_ARATH At5g48370 OS=Arabidopsis thaliana OX=3702 GN=At5g48370 PE=1 SV=1
11	PDB:6x7lA	0.468	0.565	1.561E-9	303	0.089	0.112	6x7lA.pdb.gz	Structures of LnmK, a Bifunctional Acyltransferase/Decarboxylase, with Substrate Analogues Reveal the Basis for Selectivity and Stereospecificity.
12	PDB:1c8uA	0.420	0.544	2.827E-9	285	0.097	0.130	1c8uA.pdb.gz
13	PDB:2bi0A	0.413	0.467	4.849E-9	330	0.095	0.109	2bi0A.pdb.gz
14	PDB:4e3eA	0.349	0.374	3.205E-8	351	0.089	0.097	4e3eA.pdb.gz
15	PDB:7cpxA	0.452	0.087	1.452E-7	2262	0.097	0.016	7cpxA.pdb.gz	Structural basis for the biosynthesis of lovastatin.
16	PDB:7mkuA	0.333	0.407	1.707E-7	302	0.050	0.063	7mkuA.pdb.gz
17	PDB:3omlA	0.351	0.265	5.596E-7	532	0.079	0.056	3omlA.pdb.gz
18	PDB:6wc7G	0.386	0.354	2.402E-6	422	0.092	0.083	6wc7G.pdb.gz
19	PDB:4k00A	0.249	0.619	2.535E-6	137	0.074	0.204	4k00A.pdb.gz
20	PDB:4oobA	0.350	0.501	5.113E-6	245	0.079	0.122	4oobA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00154	0.0	790	380	1.000	1.000	BACH_HUMAN Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7 PE=1 SV=3
2	Q64559	0.0	688	381	0.887	0.885	BACH_RAT Cytosolic acyl coenzyme A thioester hydrolase OS=Rattus norvegicus OX=10116 GN=Acot7 PE=1 SV=4
3	Q91V12	0.0	695	381	0.892	0.890	BACH_MOUSE Cytosolic acyl coenzyme A thioester hydrolase OS=Mus musculus OX=10090 GN=Acot7 PE=1 SV=2
4	Q6ZUV0	6.38e-164	461	252	0.584	0.881	BACHL_HUMAN Putative cytosolic acyl coenzyme A thioester hydrolase-like OS=Homo sapiens OX=9606 GN=ACOT7L PE=5 SV=1
5	Q8WYK0	9.94e-18	87.0	555	0.213	0.146	ACO12_HUMAN Acetyl-coenzyme A thioesterase OS=Homo sapiens OX=9606 GN=ACOT12 PE=1 SV=1
6	Q99NB7	8.60e-17	84.0	556	0.211	0.144	ACO12_RAT Acetyl-coenzyme A thioesterase OS=Rattus norvegicus OX=10116 GN=Acot12 PE=1 SV=1
7	Q9DBK0	7.44e-16	81.3	556	0.211	0.144	ACO12_MOUSE Acetyl-coenzyme A thioesterase OS=Mus musculus OX=10090 GN=Acot12 PE=1 SV=1
8	Q8VHQ9	4.15e-13	72.8	594	0.187	0.120	ACO11_MOUSE Acyl-coenzyme A thioesterase 11 OS=Mus musculus OX=10090 GN=Acot11 PE=1 SV=1
9	Q8WXI4	3.09e-12	70.1	607	0.187	0.117	ACO11_HUMAN Acyl-coenzyme A thioesterase 11 OS=Homo sapiens OX=9606 GN=ACOT11 PE=1 SV=1
10	Q9LK77	4.44e-07	53.9	438	0.111	0.096	Q9LK77_ARATH At5g48370 OS=Arabidopsis thaliana OX=3702 GN=At5g48370 PE=1 SV=1
11	P0A8Z0	6.32e-07	50.4	132	0.100	0.288	YCIA_ECOLI Acyl-CoA thioester hydrolase YciA OS=Escherichia coli (strain K12) OX=83333 GN=yciA PE=3 SV=1
12	S4TF94	1.12e-06	52.8	527	0.108	0.078	TE4_HUMLU Acyl-coenzyme A thioesterase 4, mitochondrial OS=Humulus lupulus OX=3486 GN=TE4 PE=1 SV=1
13	Q9Y305	3.84e-05	47.8	439	0.195	0.169	ACOT9_HUMAN Acyl-coenzyme A thioesterase 9, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT9 PE=1 SV=2
14	Q580L6	5.38e-04	43.9	368	0.174	0.179	Q580L6_TRYB2 HotDog ACOT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.470 PE=4 SV=1
15	Q9R0X4	0.004	41.6	439	0.182	0.157	ACOT9_MOUSE Acyl-coenzyme A thioesterase 9, mitochondrial OS=Mus musculus OX=10090 GN=Acot9 PE=1 SV=1
16	Q32MW3	0.007	40.8	439	0.182	0.157	ACO10_MOUSE Acyl-coenzyme A thioesterase 10, mitochondrial OS=Mus musculus OX=10090 GN=Acot10 PE=2 SV=1
17	Q6DFZ5	0.027	38.9	541	0.150	0.105	Q6DFZ5_DANRE Solute carrier family 2 member 3a OS=Danio rerio OX=7955 GN=zgc:92476 PE=1 SV=1
18	P77454	2.0	32.7	310	0.074	0.090	GLSA1_ECOLI Glutaminase 1 OS=Escherichia coli (strain K12) OX=83333 GN=glsA1 PE=1 SV=1
19	P56716	2.5	33.1	2095	0.095	0.017	RP1_MOUSE Oxygen-regulated protein 1 OS=Mus musculus OX=10090 GN=Rp1 PE=1 SV=2
20	Q57X55	6.2	31.6	675	0.103	0.058	Q57X55_TRYB2 threonine synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.1130 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03061 4HBT	9.1e-29	110.9	Thioesterase superfamily
2	PF16136 NINJA_B	20	17.1	Putative nuclear localisation signal
3	PF07986 TBCC	6.2e+02	11.6	Tubulin binding cofactor C
4	PF01336 tRNA_anti-codon	2.9	19.3	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367086

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311224	0.939	Acyl-coenzyme A thioesterase 1
2	9606.ENSP00000215567	0.900	Very-long-chain enoyl-CoA reductase
3	9606.ENSP00000238651	0.888	Acyl-coenzyme A thioesterase 2, mitochondrial
4	9606.ENSP00000323071	0.881	Acyl-coenzyme A thioesterase 4
5	9606.ENSP00000357804	0.835	Acyl-coenzyme A thioesterase THEM4
6	9606.ENSP00000357807	0.823	Acyl-coenzyme A thioesterase THEM5
7	9606.ENSP00000230048	0.809	Acyl-coenzyme A thioesterase 13
8	9606.ENSP00000367595	0.702	Tumor protein p63 regulated 1 like
9	9606.ENSP00000380495	0.689	ATP-dependent RNA helicase DDX51
10	9606.ENSP00000270708	0.685	WD repeat-containing protein WRAP73
11	9606.ENSP00000367629	0.662	Rho guanine nucleotide exchange factor 16
12	9606.ENSP00000229239	0.647	Glyceraldehyde-3-phosphate dehydrogenase
13	9606.ENSP00000316909	0.641	Vesicular glutamate transporter 3
14	9606.ENSP00000376703	0.641	Anoctamin-4
15	9606.ENSP00000393097	0.641	Gamma-aminobutyric acid receptor subunit alpha-1
16	9606.ENSP00000306614	0.618	Peptidyl-prolyl cis-trans isomerase H
17	9606.ENSP00000303246	0.613	Acyl-coenzyme A thioesterase 12
18	9606.ENSP00000358307	0.612	Required for normal embryonic development.
19	9606.ENSP00000358695	0.596	Cytochrome b5 reductase 4
20	9606.ENSP00000356782	0.595	Golgin-45

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0016290	0.995	palmitoyl-CoA hydrolase activity
GO:0042802	0.977	identical protein binding
GO:0097159	0.762	organic cyclic compound binding
GO:1901363	0.708	heterocyclic compound binding
GO:0032559	0.397	adenyl ribonucleotide binding
GO:0120227	0.373	acyl-CoA binding
GO:1901567	0.333	fatty acid derivative binding
GO:0000062	0.311	fatty-acyl-CoA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:1901575	0.991	organic substance catabolic process
GO:0006629	0.991	lipid metabolic process
GO:0044248	0.991	cellular catabolic process
GO:0006631	0.975	fatty acid metabolic process
GO:0016042	0.970	lipid catabolic process
GO:1901360	0.865	organic cyclic compound metabolic process
GO:0006807	0.843	nitrogen compound metabolic process
GO:1901564	0.801	organonitrogen compound metabolic process
GO:0034641	0.725	cellular nitrogen compound metabolic process
GO:0006725	0.695	cellular aromatic compound metabolic process
GO:0009058	0.679	biosynthetic process
GO:0019637	0.669	organophosphate metabolic process
GO:1901135	0.656	carbohydrate derivative metabolic process
GO:0006796	0.636	phosphate-containing compound metabolic process
GO:0006139	0.633	nucleobase-containing compound metabolic process
GO:1901576	0.594	organic substance biosynthetic process
GO:0044249	0.582	cellular biosynthetic process
GO:0009150	0.469	purine ribonucleotide metabolic process
GO:0008610	0.379	lipid biosynthetic process
GO:0006637	0.349	acyl-CoA metabolic process
GO:1901362	0.304	organic cyclic compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070013	0.985	intracellular organelle lumen
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0016020	0.866	membrane
GO:0005634	0.841	nucleus
GO:0031981	0.736	nuclear lumen
GO:0031982	0.663	vesicle
GO:0005654	0.543	nucleoplasm
GO:0005576	0.513	extracellular region
GO:0012505	0.325	endomembrane system
GO:0005615	0.311	extracellular space
GO:0005886	0.310	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16645	0.995	H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate
EC:3.1.2.2	0.995	palmitoyl-CoA hydrolase.

[back to server]