StarFunc result for job id O00160

User Input

>input (1098 residues)
MGSKERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYIGSVLISVNPF
KQMPYFTDREIDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAA
KYIMGYISKVSGGGEKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGG
EPDGGKISNFLLEKSRVVMQNENERNFHIYYQLLEGASQEQRQNLGLMTPDYYYYLNQSD
TYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQLVAGILHLGNISFCEDGNYARVESV
DLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTRDALAKGLYAR
LFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLK
AEQEEYVQEGIRWTPIQYFNNKVVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLL
QKLQAAVGTHEHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQTSEQAFL
RMLFPEKLDGDKKGRPSTAGSKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENR
VKHQVEYLGLKENIRVRRAGFAYRRQFAKFLQRYAILTPETWPRWRGDERQGVQHLLRAV
NMEPDQYQMGSTKVFVKNPESLFLLEEVRERKFDGFARTIQKAWRRHVAVRKYEEMREEA
SNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLGKRERVDFADSVTKYDRRFKPIKR
DLILTPKCVYVIGREKVKKGPEKGQVCEVLKKKVDIQALRGVSLSTRQDDFFILQEDAAD
SFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGD
LAVLKVGGRTLTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPP
SARGGPLPLEIMSGGGTHRPPRGPPSTSLGASRRPRARPPSEHNTEFLNVPDQGMAGMQR
KRSVGQRPVPGVGRPKPQPRTHGPRCRALYQYVGQDVDELSFNVNEVIEILMEDPSGWWK
GRLHGQEGLFPGNYVEKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FDV0	0.814	0.800	0.000	1117	0.709	0.697	E7FDV0.pdb.gz	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
2	AFDB:F1NNT7	0.687	0.686	0.000	1099	0.838	0.837	F1NNT7.pdb.gz
3	AFDB:F1QJK0	0.768	0.769	0.000	1096	0.716	0.717	F1QJK0.pdb.gz
4	AFDB:P34092	0.562	0.556	0.000	1111	0.465	0.460	P34092.pdb.gz	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2
5	AFDB:P70248	0.820	0.819	0.000	1099	0.902	0.901	P70248.pdb.gz	MYO1F_MOUSE Unconventional myosin-If OS=Mus musculus OX=10090 GN=Myo1f PE=1 SV=1
6	AFDB:Q12965	0.692	0.686	0.000	1108	0.727	0.720	Q12965.pdb.gz	MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2
7	AFDB:P34109	0.578	0.574	3.483E-104	1109	0.410	0.406	P34109.pdb.gz	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
8	AFDB:Q04439	0.567	0.513	3.387E-102	1219	0.409	0.368	Q04439.pdb.gz	MYO5_YEAST Myosin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO5 PE=1 SV=1
9	AFDB:Q2US45	0.563	0.493	4.955E-102	1261	0.404	0.352	Q2US45.pdb.gz	MYO1_ASPOR Myosin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=myoA PE=3 SV=1
10	AFDB:Q00647	0.580	0.512	1.706E-101	1249	0.412	0.362	Q00647.pdb.gz	MYO1_EMENI Myosin-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=myoA PE=1 SV=2
11	PDB:4anjA	0.548	0.603	3.081E-59	995	0.254	0.280	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:4pa0A	0.504	0.566	1.330E-55	974	0.257	0.290	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.500	0.594	4.493E-54	920	0.248	0.296	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4p7hB	0.507	0.582	5.328E-53	952	0.240	0.277	4p7hB.pdb.gz
15	PDB:6ycxB	0.573	0.759	1.315E-52	817	0.192	0.258	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
16	PDB:7mf3B	0.589	0.716	5.506E-45	896	0.233	0.286	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.551	0.628	1.080E-42	954	0.243	0.280	5tbyA.pdb.gz
18	PDB:2lqnA	0.051	0.176	7.337E-4	303	0.020	0.073	2lqnA.pdb.gz
19	PDB:2dybA	0.051	0.185	1.497E-3	298	0.016	0.060	2dybA.pdb.gz
20	PDB:3qwyA	0.050	0.314	2.409E-3	170	0.015	0.100	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286Y9H2	647	1069	0.306	0.314	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	A0A2R8Q9G7	645	1068	0.306	0.315	A0A2R8Q9G7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=fj81f11 PE=1 SV=1
3	A5PF48	592	1026	0.284	0.304	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
4	B0I1S9	626	1136	0.296	0.286	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
5	E7F5R7	647	1043	0.306	0.322	E7F5R7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1c PE=1 SV=3
6	E7FDV0	1617	1117	0.714	0.702	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
7	E9PDF6	625	1107	0.296	0.294	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
8	E9Q634	1637	1107	0.726	0.720	MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1
9	F5H6E2	629	1039	0.301	0.318	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
10	O00159	629	1063	0.301	0.310	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
11	O00160	2281	1098	1.000	1.000	MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens OX=9606 GN=MYO1F PE=1 SV=3
12	O43795	626	1136	0.296	0.286	MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3
13	O88329	593	1043	0.291	0.306	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
14	P22467	743	994	0.356	0.393	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
15	P34092	938	1111	0.471	0.465	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2
16	P34109	796	1109	0.393	0.389	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
17	P36006	743	1272	0.375	0.324	MYO3_YEAST Myosin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO3 PE=1 SV=4
18	P42522	796	1182	0.447	0.415	MYOC_DICDI Myosin IC heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoC PE=1 SV=2
19	P46735	619	1107	0.293	0.291	MYO1B_MOUSE Unconventional myosin-Ib OS=Mus musculus OX=10090 GN=Myo1b PE=1 SV=3
20	P47807	612	1045	0.302	0.318	MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus OX=9031 GN=MYO1A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.8e+02	13.9	AAA ATPase domain
2	PF13401 AAA_22	4.4e+02	12.5	AAA domain
3	PF00005 ABC_tran	2e+02	13.9	ABC transporter
4	PF09848 DUF2075	3.8e+02	11.7	Schlafen group 3, DNA/RNA helicase domain
5	PF07475 Hpr_kinase_C	6.3e+02	11.3	HPr Serine kinase C-terminal domain
6	PF00612 IQ	2e+02	13.2	IQ calmodulin-binding motif
7	PF00063 Myosin_head	5.9e-246	829.6	Myosin head (motor domain)
8	PF06017 Myosin_TH1	1.1e-47	173.7	Unconventional myosin tail, actin- and lipid-binding
9	PF00018 SH3_1	1.4e-10	51.9	SH3 domain
10	PF07653 SH3_2	1.1e-07	42.9	Variant SH3 domain
11	PF14604 SH3_9	9.4e-11	52.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344871

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334563	0.918	Unconventional myosin-XVIIIb
2	9606.ENSP00000358994	0.913	Unconventional myosin-VI
3	9606.ENSP00000348349	0.912	Unconventional myosin-IXa
4	9606.ENSP00000352834	0.912	Unconventional myosin-Ic
5	9606.ENSP00000365891	0.891	Wiskott-Aldrich syndrome protein
6	9606.ENSP00000223023	0.835	Neural Wiskott-Aldrich syndrome protein
7	9606.ENSP00000262629	0.816	TYRO protein tyrosine kinase-binding protein
8	9606.ENSP00000367220	0.807	Actin-related protein 2
9	9606.ENSP00000450385	0.792	Myosin light chain 6B
10	9606.ENSP00000446955	0.791	Myosin light polypeptide 6
11	9606.ENSP00000377504	0.745	Zinc finger protein 414
12	9606.ENSP00000376330	0.742	WAS/WASL-interacting protein family member 1
13	9606.ENSP00000477310	0.731	Dynein light chain 2, cytoplasmic
14	9606.ENSP00000458162	0.730	Actin, cytoplasmic 2
15	9606.ENSP00000349960	0.728	Actin, cytoplasmic 1
16	9606.ENSP00000228825	0.726	Actin-related protein 2/3 complex subunit 3
17	9606.ENSP00000380948	0.722	Integrin beta-2
18	9606.ENSP00000272298	0.717	Calmodulin 2 (phosphorylase kinase, delta)
19	9606.ENSP00000291295	0.717	Calmodulin 3 (phosphorylase kinase, delta)
20	9606.ENSP00000349467	0.717	Calmodulin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0140657	0.991	ATP-dependent activity
GO:0003774	0.990	cytoskeletal motor activity
GO:0008092	0.987	cytoskeletal protein binding
GO:0000146	0.975	microfilament motor activity
GO:0003779	0.949	actin binding
GO:0044877	0.889	protein-containing complex binding
GO:0051015	0.795	actin filament binding
GO:0008289	0.662	lipid binding
GO:0005543	0.627	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0065007	0.909	biological regulation
GO:0050789	0.880	regulation of biological process
GO:0050794	0.825	regulation of cellular process
GO:0050896	0.651	response to stimulus
GO:0032501	0.607	multicellular organismal process
GO:0032502	0.511	developmental process
GO:0048856	0.469	anatomical structure development
GO:0048518	0.434	positive regulation of biological process
GO:0048522	0.393	positive regulation of cellular process
GO:0051179	0.331	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.998	cell periphery
GO:0005737	0.998	cytoplasm
GO:0005829	0.994	cytosol
GO:0043229	0.989	intracellular organelle
GO:0005886	0.980	plasma membrane
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0032991	0.967	protein-containing complex
GO:0043227	0.967	membrane-bounded organelle
GO:0005856	0.886	cytoskeleton
GO:0031982	0.854	vesicle
GO:0005576	0.836	extracellular region
GO:0015629	0.816	actin cytoskeleton
GO:0042995	0.772	cell projection
GO:0043231	0.723	intracellular membrane-bounded organelle
GO:0043230	0.714	extracellular organelle
GO:1903561	0.695	extracellular vesicle
GO:0120025	0.669	plasma membrane bounded cell projection
GO:0070062	0.660	extracellular exosome
GO:0031253	0.421	cell projection membrane
GO:0031252	0.403	cell leading edge
GO:0098858	0.383	actin-based cell projection
GO:0099513	0.381	polymeric cytoskeletal fiber
GO:0031410	0.344	cytoplasmic vesicle
GO:0005884	0.323	actin filament
GO:0005902	0.317	microvillus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.975	myosin ATPase.

[back to server]