StarFunc result for job id O00165

User Input

>input (279 residues)
MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEE
FGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLR
EGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPR
TREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTV
TRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z591	0.442	0.442	9.570E-43	279	1.000	1.000	A0A0S2Z591.pdb.gz	A0A0S2Z591_HUMAN HCLS1 associated protein X-1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=HAX1 PE=2 SV=1
2	AFDB:O35387	0.419	0.418	3.821E-34	280	0.817	0.814	O35387.pdb.gz	HAX1_MOUSE HCLS1-associated protein X-1 OS=Mus musculus OX=10090 GN=Hax1 PE=1 SV=1
3	AFDB:F1RGL0	0.332	0.327	7.409E-34	284	0.839	0.824	F1RGL0.pdb.gz	F1RGL0_PIG HCLS1-associated protein X-1 OS=Sus scrofa OX=9823 GN=HAX1 PE=1 SV=2
4	AFDB:Q5VYD6	0.194	0.210	2.663E-18	255	0.591	0.647	Q5VYD6.pdb.gz	Q5VYD6_HUMAN HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1 PE=1 SV=2
5	AFDB:E9Q5K1	0.114	0.111	7.081E-3	292	0.158	0.151	E9Q5K1.pdb.gz	E9Q5K1_MOUSE Transcription factor-like 5 (basic helix-loop-helix) OS=Mus musculus OX=10090 GN=Tcfl5 PE=1 SV=1
6	AFDB:Q10234	0.089	0.071	1.747E-2	387	0.104	0.075	Q10234.pdb.gz	RT05_SCHPO Small ribosomal subunit protein uS5m OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrp5 PE=1 SV=1
7	PDB:2dsbA	0.106	0.138	5.820E-2	206	0.032	0.044	2dsbA.pdb.gz
8	AFDB:E9Q5G3	0.096	0.039	7.408E-2	953	0.136	0.040	E9Q5G3.pdb.gz	KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus OX=10090 GN=Kif23 PE=1 SV=1
9	AFDB:Q57UM9	0.099	0.021	7.868E-2	1649	0.118	0.020	Q57UM9.pdb.gz	Q57UM9_TRYB2 DNA-directed DNA polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.670 PE=4 SV=1
10	AFDB:P87240	0.095	0.089	8.356E-2	306	0.118	0.108	P87240.pdb.gz	NOT2_SCHPO General negative regulator of transcription subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not2 PE=1 SV=2
11	AFDB:Q5EGE1	0.138	0.092	9.425E-2	461	0.154	0.093	Q5EGE1.pdb.gz	ISM1_DANRE Isthmin-1 OS=Danio rerio OX=7955 GN=ism1 PE=2 SV=1
12	PDB:3omlA	0.094	0.055	1.827E-1	532	0.047	0.024	3omlA.pdb.gz
13	PDB:2n6fA	0.116	0.217	2.060E-1	136	0.036	0.074	2n6fA.pdb.gz
14	PDB:5iv5BD	0.117	0.223	2.188E-1	126	0.029	0.063	5iv5BD.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
15	PDB:5t43A	0.123	0.207	2.621E-1	158	0.039	0.070	5t43A.pdb.gz
16	PDB:3gyxB	0.095	0.146	2.784E-1	166	0.029	0.048	3gyxB.pdb.gz	Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit
17	PDB:4g1eB	0.109	0.047	2.957E-1	709	0.050	0.020	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
18	PDB:2hqsA	0.127	0.087	3.542E-1	412	0.022	0.015	2hqsA.pdb.gz
19	PDB:5w5yO	0.085	0.039	5.083E-1	640	0.025	0.011	5w5yO.pdb.gz	Structural mechanism of ATP-independent transcription initiation by RNA polymerase I.
20	PDB:4d61h	0.082	0.055	5.398E-1	436	0.029	0.018	4d61h.pdb.gz	Cryo-Em of Ribosomal 80S Complexes with Termination Factors Reveals the Translocated Cricket Paralysis Virus Ires.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z591	0.0	550	279	1.000	1.000	A0A0S2Z591_HUMAN HCLS1 associated protein X-1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=HAX1 PE=2 SV=1
2	O00165	0.0	550	279	1.000	1.000	HAX1_HUMAN HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1 PE=1 SV=2
3	A0A0S2Z565	2.16e-155	434	231	0.828	1.000	A0A0S2Z565_HUMAN HCLS1 associated protein X-1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=HAX1 PE=2 SV=1
4	F1RGL0	9.08e-153	429	284	0.835	0.820	F1RGL0_PIG HCLS1-associated protein X-1 OS=Sus scrofa OX=9823 GN=HAX1 PE=1 SV=2
5	O35387	6.39e-148	417	280	0.810	0.807	HAX1_MOUSE HCLS1-associated protein X-1 OS=Mus musculus OX=10090 GN=Hax1 PE=1 SV=1
6	Q7TSE9	3.20e-145	410	278	0.810	0.813	HAX1_RAT HCLS1-associated protein X-1 OS=Rattus norvegicus OX=10116 GN=Hax1 PE=1 SV=1
7	Q5VYD6	1.96e-112	327	283	0.717	0.707	Q5VYD6_HUMAN HCLS1-associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1 PE=1 SV=2
8	E9PIQ7	5.20e-104	301	151	0.541	1.000	E9PIQ7_HUMAN HCLS1 associated protein X-1 OS=Homo sapiens OX=9606 GN=HAX1 PE=1 SV=1
9	Q08890	0.046	37.4	552	0.115	0.058	IDS_MOUSE Iduronate 2-sulfatase OS=Mus musculus OX=10090 GN=Ids PE=2 SV=3
10	Q6MWW2	0.51	33.9	286	0.100	0.098	CHSH3_MYCTU Enoyl-CoA hydratase ChsH3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=chsH3 PE=1 SV=1
11	P53819	7.2	30.8	1859	0.061	0.009	YRF16_YEAST Y' element ATP-dependent helicase protein 1 copy 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-6 PE=2 SV=1
12	P0CX14	7.3	30.8	1859	0.061	0.009	YRF13_YEAST Y' element ATP-dependent helicase protein 1 copy 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-3 PE=2 SV=1
13	P0CX15	7.3	30.8	1859	0.061	0.009	YRF17_YEAST Y' element ATP-dependent helicase protein 1 copy 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-7 PE=2 SV=1
14	P40105	7.3	30.8	1681	0.061	0.010	YRF12_YEAST Y' element ATP-dependent helicase protein 1 copy 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-2 PE=2 SV=2
15	Q9VEU5	7.8	30.4	669	0.047	0.019	GCYDB_DROME Soluble guanylate cyclase 89Db OS=Drosophila melanogaster OX=7227 GN=Gyc89Db PE=1 SV=1
16	P0CX20	8.1	30.8	1796	0.061	0.009	YRF11_YEAST Y' element ATP-dependent helicase protein 1 copy 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-1 PE=2 SV=1
17	P0CX21	8.1	30.8	1796	0.061	0.009	YRF15_YEAST Y' element ATP-dependent helicase protein 1 copy 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRF1-5 PE=2 SV=1
18	Q03099	8.2	30.4	1374	0.061	0.012	YMN3_YEAST Y' element ATP-dependent helicase YML133C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YML133C PE=2 SV=1
19	Q9VEU6	8.6	30.4	667	0.047	0.019	GCYDA_DROME Soluble guanylate cyclase 89Da OS=Drosophila melanogaster OX=7227 GN=Gyc89Da PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10248 Mlf1IP	7.9e+02	11.4	Myelodysplasia-myeloid leukemia factor 1-interacting protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329002

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365745	0.953	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
2	9606.ENSP00000237596	0.945	Polycystin-2
3	9606.ENSP00000263339	0.945	Interleukin-1 alpha
4	9606.ENSP00000335153	0.945	Heat shock protein HSP 90-alpha
5	9606.ENSP00000258080	0.890	Serine protease HTRA2, mitochondrial
6	9606.ENSP00000325421	0.889	Presenilins-associated rhomboid-like protein, mitochondrial
7	9606.ENSP00000330237	0.864	Caspase-9
8	9606.ENSP00000269097	0.833	Glucose-6-phosphatase 3
9	9606.ENSP00000457408	0.775	Uncharacterized protein KIAA0513
10	9606.ENSP00000324729	0.729	Protein salvador homolog 1
11	9606.ENSP00000300249	0.701	Microtubule-associated protein RP/EB family member 2
12	9606.ENSP00000266529	0.694	Zinc finger CCHC-type and RNA binding motif containing 1
13	9606.ENSP00000320176	0.691	Hematopoietic lineage cell-specific protein
14	9606.ENSP00000466090	0.688	Neutrophil elastase
15	9606.ENSP00000360609	0.685	Heat shock protein HSP 90-beta
16	9606.ENSP00000306106	0.682	Protein jagunal homolog 1
17	9606.ENSP00000359357	0.676	Zinc finger protein Gfi-1
18	9606.ENSP00000355890	0.674	Bifunctional glutamate/proline--tRNA ligase
19	9606.ENSP00000305193	0.673	HCLS1-binding protein 3
20	9606.ENSP00000263817	0.671	Bile salt export pump

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0048522	0.980	positive regulation of cellular process
GO:0019222	0.972	regulation of metabolic process
GO:0048583	0.956	regulation of response to stimulus
GO:0060255	0.955	regulation of macromolecule metabolic process
GO:0009966	0.954	regulation of signal transduction
GO:0051128	0.953	regulation of cellular component organization
GO:0051716	0.952	cellular response to stimulus
GO:0031323	0.951	regulation of cellular metabolic process
GO:0032879	0.949	regulation of localization
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0009893	0.945	positive regulation of metabolic process
GO:0080090	0.942	regulation of primary metabolic process
GO:0016043	0.941	cellular component organization
GO:0051173	0.931	positive regulation of nitrogen compound metabolic process
GO:0010821	0.909	regulation of mitochondrion organization
GO:0060341	0.900	regulation of cellular localization
GO:0051246	0.900	regulation of protein metabolic process
GO:1902531	0.889	regulation of intracellular signal transduction
GO:0051049	0.860	regulation of transport
GO:0032386	0.848	regulation of intracellular transport
GO:0032970	0.843	regulation of actin filament-based process
GO:0010604	0.841	positive regulation of macromolecule metabolic process
GO:0065008	0.837	regulation of biological quality
GO:0031325	0.837	positive regulation of cellular metabolic process
GO:0032880	0.833	regulation of protein localization
GO:0032956	0.832	regulation of actin cytoskeleton organization
GO:0042325	0.803	regulation of phosphorylation
GO:0051247	0.801	positive regulation of protein metabolic process
GO:1902903	0.786	regulation of supramolecular fiber organization
GO:0031399	0.783	regulation of protein modification process
GO:1903747	0.775	regulation of establishment of protein localization to mitochondrion
GO:0048584	0.762	positive regulation of response to stimulus
GO:0051896	0.759	regulation of protein kinase B signaling
GO:1902107	0.759	positive regulation of leukocyte differentiation
GO:2000249	0.757	regulation of actin cytoskeleton reorganization
GO:0044087	0.748	regulation of cellular component biogenesis
GO:0033157	0.743	regulation of intracellular protein transport
GO:0031401	0.739	positive regulation of protein modification process
GO:0030832	0.734	regulation of actin filament length
GO:0045937	0.711	positive regulation of phosphate metabolic process
GO:0001932	0.710	regulation of protein phosphorylation
GO:0048523	0.682	negative regulation of cellular process
GO:0014066	0.669	regulation of phosphatidylinositol 3-kinase signaling
GO:0009967	0.668	positive regulation of signal transduction
GO:0002763	0.662	positive regulation of myeloid leukocyte differentiation
GO:0001934	0.656	positive regulation of protein phosphorylation
GO:0043254	0.653	regulation of protein-containing complex assembly
GO:0008064	0.645	regulation of actin polymerization or depolymerization
GO:0032271	0.641	regulation of protein polymerization
GO:0023052	0.632	signaling
GO:0007154	0.632	cell communication
GO:1903533	0.632	regulation of protein targeting
GO:0033135	0.632	regulation of peptidyl-serine phosphorylation
GO:1902533	0.608	positive regulation of intracellular signal transduction
GO:0033138	0.577	positive regulation of peptidyl-serine phosphorylation
GO:0051897	0.571	positive regulation of protein kinase B signaling
GO:0007165	0.499	signal transduction
GO:0009894	0.494	regulation of catabolic process
GO:0051130	0.463	positive regulation of cellular component organization
GO:0042981	0.457	regulation of apoptotic process
GO:0031329	0.444	regulation of cellular catabolic process
GO:0042221	0.433	response to chemical
GO:0010638	0.433	positive regulation of organelle organization
GO:0010468	0.414	regulation of gene expression
GO:0071310	0.402	cellular response to organic substance
GO:0010556	0.374	regulation of macromolecule biosynthetic process
GO:0031326	0.374	regulation of cellular biosynthetic process
GO:0019219	0.374	regulation of nucleobase-containing compound metabolic process
GO:0010506	0.364	regulation of autophagy
GO:0051252	0.362	regulation of RNA metabolic process
GO:0050730	0.343	regulation of peptidyl-tyrosine phosphorylation
GO:1903146	0.340	regulation of autophagy of mitochondrion
GO:0051495	0.334	positive regulation of cytoskeleton organization
GO:0050731	0.329	positive regulation of peptidyl-tyrosine phosphorylation
GO:0060548	0.327	negative regulation of cell death
GO:0008152	0.321	metabolic process
GO:0043069	0.321	negative regulation of programmed cell death
GO:0043066	0.313	negative regulation of apoptotic process
GO:0010557	0.303	positive regulation of macromolecule biosynthetic process
GO:0006357	0.303	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.962	membrane
GO:0012505	0.851	endomembrane system
GO:0005829	0.628	cytosol
GO:0005634	0.557	nucleus
GO:0070013	0.523	intracellular organelle lumen
GO:0032991	0.521	protein-containing complex
GO:0005783	0.418	endoplasmic reticulum
GO:0031981	0.369	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]