StarFunc result for job id O00168

User Input

>input (92 residues)
MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRC
RCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00168	1.000	1.000	1.440E-14	92	1.000	1.000	O00168.pdb.gz	PLM_HUMAN Phospholemman OS=Homo sapiens OX=9606 GN=FXYD1 PE=1 SV=2
2	AFDB:O08589	0.697	0.697	9.341E-12	92	0.837	0.837	O08589.pdb.gz	PLM_RAT Phospholemman OS=Rattus norvegicus OX=10116 GN=Fxyd1 PE=1 SV=2
3	AFDB:I3LMB3	0.614	0.645	3.645E-8	87	0.652	0.690	I3LMB3.pdb.gz	PLM_PIG Phospholemman OS=Sus scrofa OX=9823 GN=FXYD1 PE=1 SV=2
4	AFDB:Q9H0Q3	0.544	0.529	2.654E-4	95	0.435	0.421	Q9H0Q3.pdb.gz	FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 OS=Homo sapiens OX=9606 GN=FXYD6 PE=1 SV=1
5	AFDB:Q63113	0.517	0.544	7.599E-3	87	0.272	0.287	Q63113.pdb.gz	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
6	AFDB:Q58K79	0.391	0.535	1.260E-1	65	0.239	0.338	Q58K79.pdb.gz	Q58K79_PIG FXYD domain-containing ion transport regulator OS=Sus scrofa OX=9823 GN=FXYD2 PE=1 SV=1
7	AFDB:C0HJJ0	0.383	0.504	1.722E-1	69	0.217	0.290	C0HJJ0.pdb.gz	FXY11_DANRE FXYD domain-containing ion transport regulator 11 OS=Danio rerio OX=7955 GN=fxyd11 PE=1 SV=1
8	PDB:2jp3A	0.309	0.391	5.434E-1	67	0.250	0.343	2jp3A.pdb.gz
9	AFDB:Q8LGA5	0.370	0.125	8.860E-1	368	0.207	0.052	Q8LGA5.pdb.gz	ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana OX=3702 GN=ATL31 PE=1 SV=2
10	PDB:7sqkE	0.323	0.066	1.282	610	0.174	0.026	7sqkE.pdb.gz
11	AFDB:Q05899	0.354	0.282	1.415	129	0.185	0.132	Q05899.pdb.gz	YL297_YEAST Uncharacterized vacuolar protein YLR297W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR297W PE=1 SV=1
12	AFDB:H2L0C3	0.326	0.074	1.933	458	0.185	0.037	H2L0C3.pdb.gz	H2L0C3_CAEEL Dystroglycan-type cadherin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sgca-1 PE=1 SV=1
13	PDB:7w59R	0.287	0.104	4.466	280	0.130	0.043	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
14	PDB:5apny	0.278	0.145	6.101	211	0.130	0.057	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
15	PDB:6e1pA	0.289	0.054	6.101	646	0.130	0.019	6e1pA.pdb.gz	Structural basis for activation of voltage sensor domains in an ion channel TPC1.
16	PDB:7rroB0	0.361	0.191	7.131	189	0.109	0.053	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:6epcJ	0.299	0.090	7.709	406	0.120	0.027	6epcJ.pdb.gz	In Situ Structure of Neuronal C9orf72 Poly-GA Aggregates Reveals Proteasome Recruitment.
18	PDB:5iklB	0.284	0.073	8.335	514	0.098	0.018	5iklB.pdb.gz
19	PDB:3epyA	0.292	0.303	9.011	88	0.141	0.148	3epyA.pdb.gz	Crystal Structure of human acyl-CoA binding domain 7 complexed with palmitoyl-Coa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00168	1.07e-63	189	92	1.000	1.000	PLM_HUMAN Phospholemman OS=Homo sapiens OX=9606 GN=FXYD1 PE=1 SV=2
2	Q3SZX0	4.20e-58	174	92	0.902	0.902	PLM_BOVIN Phospholemman OS=Bos taurus OX=9913 GN=FXYD1 PE=1 SV=1
3	P56513	1.72e-56	171	92	0.891	0.891	PLM_CANLF Phospholemman OS=Canis lupus familiaris OX=9615 GN=FXYD1 PE=1 SV=1
4	O08589	2.06e-43	137	92	0.837	0.837	PLM_RAT Phospholemman OS=Rattus norvegicus OX=10116 GN=Fxyd1 PE=1 SV=2
5	I3LMB3	1.23e-38	125	87	0.630	0.667	PLM_PIG Phospholemman OS=Sus scrofa OX=9823 GN=FXYD1 PE=1 SV=2
6	Q9Z239	8.43e-35	116	92	0.707	0.707	PLM_MOUSE Phospholemman OS=Mus musculus OX=10090 GN=Fxyd1 PE=1 SV=1
7	Q9H0Q3	1.45e-21	82.8	95	0.467	0.453	FXYD6_HUMAN FXYD domain-containing ion transport regulator 6 OS=Homo sapiens OX=9606 GN=FXYD6 PE=1 SV=1
8	Q9D164	3.35e-21	81.6	94	0.435	0.426	FXYD6_MOUSE FXYD domain-containing ion transport regulator 6 OS=Mus musculus OX=10090 GN=Fxyd6 PE=1 SV=2
9	Q14802	4.32e-15	66.2	87	0.293	0.310	FXYD3_HUMAN FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1
10	Q61835	4.68e-15	65.9	88	0.315	0.330	FXYD3_MOUSE FXYD domain-containing ion transport regulator 3 OS=Mus musculus OX=10090 GN=Fxyd3 PE=1 SV=1
11	P54710	7.35e-15	65.1	66	0.337	0.470	ATNG_HUMAN Sodium/potassium-transporting ATPase subunit gamma OS=Homo sapiens OX=9606 GN=FXYD2 PE=1 SV=3
12	P58549	2.15e-12	58.9	80	0.250	0.287	FXYD7_HUMAN FXYD domain-containing ion transport regulator 7 OS=Homo sapiens OX=9606 GN=FXYD7 PE=1 SV=1
13	P59646	5.19e-12	58.2	89	0.250	0.258	FXYD4_HUMAN FXYD domain-containing ion transport regulator 4 OS=Homo sapiens OX=9606 GN=FXYD4 PE=3 SV=2
14	Q04646	1.38e-11	56.6	70	0.239	0.314	ATNG_MOUSE Sodium/potassium-transporting ATPase subunit gamma OS=Mus musculus OX=10090 GN=Fxyd2 PE=1 SV=2
15	Q04679	1.63e-11	56.2	66	0.239	0.333	ATNG_RAT Sodium/potassium-transporting ATPase subunit gamma OS=Rattus norvegicus OX=10116 GN=Fxyd2 PE=2 SV=2
16	Q58K79	1.82e-10	53.5	65	0.261	0.369	Q58K79_PIG FXYD domain-containing ion transport regulator OS=Sus scrofa OX=9823 GN=FXYD2 PE=1 SV=1
17	Q63113	1.11e-09	52.4	87	0.272	0.287	FXYD4_RAT FXYD domain-containing ion transport regulator 4 OS=Rattus norvegicus OX=10116 GN=Fxyd4 PE=1 SV=1
18	P59649	4.20e-08	48.1	80	0.217	0.250	FXYD7_RAT FXYD domain-containing ion transport regulator 7 OS=Rattus norvegicus OX=10116 GN=Fxyd7 PE=1 SV=1
19	B0S4R3	1.82e-07	46.2	70	0.217	0.286	B0S4R3_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11a PE=2 SV=1
20	B0S4R4	2.28e-07	45.8	70	0.217	0.286	B0S4R4_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02038 ATP1G1_PLM_MAT8	4.1e-23	91.8	ATP1G1/PLM/MAT8 family
2	PF20485 DUF6724	1.4e+02	13.7	Family of unknown function (DUF6724)
3	PF14575 EphA2_TM	65	15.7	Ephrin type-A receptor 2 transmembrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481244

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321106	0.962	Protachykinin-1
2	9606.ENSP00000445306	0.910	Sodium/potassium-transporting ATPase subunit alpha-1
3	9606.ENSP00000356790	0.907	Sodium/potassium-transporting ATPase subunit beta-1
4	9606.ENSP00000354490	0.906	Sodium/potassium-transporting ATPase subunit alpha-2
5	9606.ENSP00000250111	0.881	Sodium/potassium-transporting ATPase subunit beta-2
6	9606.ENSP00000444688	0.881	Sodium/potassium-transporting ATPase subunit alpha-3
7	9606.ENSP00000309591	0.853	cAMP-dependent protein kinase catalytic subunit alpha
8	9606.ENSP00000440045	0.849	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
9	9606.ENSP00000357060	0.845	Sodium/potassium-transporting ATPase subunit alpha-4
10	9606.ENSP00000218008	0.829	Protein ATP1B4
11	9606.ENSP00000286371	0.829	Sodium/potassium-transporting ATPase subunit beta-3
12	9606.ENSP00000366488	0.816	cAMP-dependent protein kinase catalytic subunit gamma
13	9606.ENSP00000292079	0.812	Sodium/potassium-transporting ATPase subunit gamma
14	9606.ENSP00000359719	0.808	cAMP-dependent protein kinase catalytic subunit beta
15	9606.ENSP00000263980	0.785	Sodium/hydrogen exchanger 1
16	9606.ENSP00000350132	0.779	Cardiac phospholamban
17	9606.ENSP00000218548	0.762	Potassium-transporting ATPase alpha chain 2
18	9606.ENSP00000344155	0.744	ATP-binding cassette sub-family A member 2
19	9606.ENSP00000272286	0.731	ATP-binding cassette sub-family G member 8
20	9606.ENSP00000260645	0.726	ATP-binding cassette sub-family G member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901702	1.000	salt transmembrane transporter activity
GO:0015103	1.000	inorganic anion transmembrane transporter activity
GO:0015075	0.998	monoatomic ion transmembrane transporter activity
GO:0022803	0.990	passive transmembrane transporter activity
GO:0008509	0.989	monoatomic anion transmembrane transporter activity
GO:0015108	0.980	chloride transmembrane transporter activity
GO:0005253	0.977	monoatomic anion channel activity
GO:0005254	0.965	chloride channel activity
GO:0098772	0.803	molecular function regulator activity
GO:0016247	0.683	channel regulator activity
GO:0099106	0.637	ion channel regulator activity
GO:0019899	0.549	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050789	0.991	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0043269	0.975	regulation of monoatomic ion transport
GO:1904062	0.968	regulation of monoatomic cation transmembrane transport
GO:0010959	0.960	regulation of metal ion transport
GO:1902305	0.951	regulation of sodium ion transmembrane transport
GO:0051234	0.901	establishment of localization
GO:0006810	0.886	transport
GO:0032501	0.875	multicellular organismal process
GO:0048518	0.803	positive regulation of biological process
GO:0009987	0.794	cellular process
GO:0044057	0.787	regulation of system process
GO:1903522	0.764	regulation of blood circulation
GO:0006811	0.723	monoatomic ion transport
GO:0008016	0.715	regulation of heart contraction
GO:0003008	0.681	system process
GO:0015698	0.428	inorganic anion transport
GO:0048878	0.423	chemical homeostasis
GO:0065008	0.381	regulation of biological quality
GO:0003012	0.355	muscle system process
GO:0019725	0.322	cellular homeostasis
GO:0030003	0.311	intracellular monoatomic cation homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0032991	0.908	protein-containing complex
GO:1902495	0.519	transmembrane transporter complex
GO:0042383	0.509	sarcolemma
GO:0098797	0.501	plasma membrane protein complex
GO:0098533	0.489	ATPase dependent transmembrane transport complex
GO:0090533	0.459	cation-transporting ATPase complex
GO:0043227	0.366	membrane-bounded organelle
GO:0043231	0.361	intracellular membrane-bounded organelle
GO:0005737	0.325	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.980	chloride(in) = chloride(out)

[back to server]