StarFunc result for job id O00175

User Input

>input (119 residues)
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00175	1.000	1.000	8.633E-22	119	1.000	1.000	O00175.pdb.gz	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
2	AFDB:Q9JKC0	0.553	0.553	1.069E-11	119	0.555	0.555	Q9JKC0.pdb.gz	CCL24_MOUSE C-C motif chemokine 24 OS=Mus musculus OX=10090 GN=Ccl24 PE=2 SV=1
3	AFDB:P10148	0.562	0.474	1.714E-9	148	0.370	0.297	P10148.pdb.gz	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
4	AFDB:P14844	0.550	0.450	3.508E-9	148	0.328	0.264	P14844.pdb.gz	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
5	AFDB:Q99616	0.538	0.647	5.060E-8	98	0.311	0.378	Q99616.pdb.gz	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
6	AFDB:P80098	0.543	0.647	5.400E-8	99	0.286	0.343	P80098.pdb.gz	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
7	AFDB:D3ZQG2	0.571	0.710	7.478E-8	94	0.319	0.404	D3ZQG2.pdb.gz	D3ZQG2_RAT C-C motif chemokine ligand 26 OS=Rattus norvegicus OX=10116 GN=Ccl26 PE=4 SV=2
8	AFDB:P51671	0.548	0.648	9.091E-8	97	0.269	0.330	P51671.pdb.gz	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
9	AFDB:P13236	0.545	0.665	9.702E-8	92	0.252	0.326	P13236.pdb.gz	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
10	AFDB:P13500	0.516	0.615	1.035E-7	99	0.277	0.333	P13500.pdb.gz	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
11	PDB:1bo0A	0.478	0.724	1.071E-6	76	0.227	0.355	1bo0A.pdb.gz
12	PDB:2ra4B	0.481	0.859	1.483E-6	65	0.252	0.462	2ra4B.pdb.gz	Structure of human monocyte chemoattractant protein 4 (MCP-4/CCL13).
13	PDB:1esrA	0.551	0.841	1.803E-6	76	0.244	0.382	1esrA.pdb.gz
14	PDB:4zltF	0.480	0.890	2.340E-6	62	0.218	0.419	4zltF.pdb.gz
15	PDB:7f1qR	0.508	0.170	7.552E-6	367	0.235	0.076	7f1qR.pdb.gz
16	PDB:2q8tB	0.490	0.874	1.357E-5	65	0.193	0.354	2q8tB.pdb.gz
17	PDB:4mheA	0.461	0.769	1.649E-5	69	0.210	0.362	4mheA.pdb.gz
18	PDB:2mpmA	0.450	0.675	1.879E-5	74	0.227	0.365	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
19	PDB:7f1tA	0.483	0.138	2.005E-5	423	0.227	0.064	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
20	PDB:1domA	0.492	0.744	2.284E-5	76	0.218	0.342	1domA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00175	2.96e-86	248	119	1.000	1.000	CCL24_HUMAN C-C motif chemokine 24 OS=Homo sapiens OX=9606 GN=CCL24 PE=1 SV=2
2	Q9JKC0	9.76e-41	133	119	0.580	0.580	CCL24_MOUSE C-C motif chemokine 24 OS=Mus musculus OX=10090 GN=Ccl24 PE=2 SV=1
3	P10148	1.87e-18	77.4	148	0.328	0.264	CCL2_MOUSE C-C motif chemokine 2 OS=Mus musculus OX=10090 GN=Ccl2 PE=1 SV=1
4	P14844	9.69e-16	70.5	148	0.269	0.216	CCL2_RAT C-C motif chemokine 2 OS=Rattus norvegicus OX=10116 GN=Ccl2 PE=2 SV=1
5	P16619	1.12e-15	68.9	93	0.244	0.312	CL3L1_HUMAN C-C motif chemokine 3-like 1 OS=Homo sapiens OX=9606 GN=CCL3L1 PE=1 SV=1
6	P10147	1.25e-15	68.6	92	0.269	0.348	CCL3_HUMAN C-C motif chemokine 3 OS=Homo sapiens OX=9606 GN=CCL3 PE=1 SV=1
7	P80098	1.68e-15	68.6	99	0.235	0.283	CCL7_HUMAN C-C motif chemokine 7 OS=Homo sapiens OX=9606 GN=CCL7 PE=1 SV=3
8	D3ZQG2	5.63e-15	68.6	150	0.261	0.207	D3ZQG2_RAT C-C motif chemokine ligand 26 OS=Rattus norvegicus OX=10116 GN=Ccl26 PE=4 SV=2
9	Q99616	1.25e-14	66.2	98	0.261	0.316	CCL13_HUMAN C-C motif chemokine 13 OS=Homo sapiens OX=9606 GN=CCL13 PE=1 SV=1
10	P80075	4.50e-14	64.7	99	0.244	0.293	CCL8_HUMAN C-C motif chemokine 8 OS=Homo sapiens OX=9606 GN=CCL8 PE=1 SV=2
11	P48298	1.42e-13	63.5	97	0.277	0.340	CCL11_MOUSE Eotaxin OS=Mus musculus OX=10090 GN=Ccl11 PE=2 SV=1
12	P97545	3.03e-13	62.8	97	0.227	0.278	CCL11_RAT Eotaxin OS=Rattus norvegicus OX=10116 GN=Ccl11 PE=3 SV=1
13	Q8NHW4	6.03e-13	61.6	92	0.210	0.272	CC4L_HUMAN C-C motif chemokine 4-like OS=Homo sapiens OX=9606 GN=CCL4L1 PE=1 SV=1
14	P51671	7.19e-13	61.6	97	0.235	0.289	CCL11_HUMAN Eotaxin OS=Homo sapiens OX=9606 GN=CCL11 PE=1 SV=1
15	P13236	1.70e-12	60.5	92	0.286	0.370	CCL4_HUMAN C-C motif chemokine 4 OS=Homo sapiens OX=9606 GN=CCL4 PE=1 SV=1
16	Q16627	3.16e-12	60.1	93	0.193	0.247	CCL14_HUMAN C-C motif chemokine 14 OS=Homo sapiens OX=9606 GN=CCL14 PE=1 SV=1
17	P55774	7.33e-12	58.9	89	0.210	0.281	CCL18_HUMAN C-C motif chemokine 18 OS=Homo sapiens OX=9606 GN=CCL18 PE=1 SV=1
18	P50230	1.05e-11	58.5	92	0.210	0.272	CCL4_RAT C-C motif chemokine 4 OS=Rattus norvegicus OX=10116 GN=Ccl4 PE=3 SV=1
19	P13500	1.13e-11	58.5	99	0.218	0.263	CCL2_HUMAN C-C motif chemokine 2 OS=Homo sapiens OX=9606 GN=CCL2 PE=1 SV=1
20	P10855	2.69e-11	57.4	92	0.218	0.283	CCL3_MOUSE C-C motif chemokine 3 OS=Mus musculus OX=10090 GN=Ccl3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00048 IL8	1.1e-14	65.7	Small cytokines (intecrine/chemokine), interleukin-8 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441600	0.998	C-C chemokine receptor type 3
2	9606.ENSP00000296140	0.820	C-C chemokine receptor type 1
3	9606.ENSP00000292303	0.806	C-C chemokine receptor type 5
4	9606.ENSP00000292301	0.799	C-C chemokine receptor type 2
5	9606.ENSP00000310405	0.794	Chemokine XC receptor 1
6	9606.ENSP00000351059	0.794	CX3C chemokine receptor 1
7	9606.ENSP00000219244	0.788	C-C motif chemokine 17
8	9606.ENSP00000326432	0.783	C-C chemokine receptor type 8
9	9606.ENSP00000319635	0.777	C-X-C chemokine receptor type 2
10	9606.ENSP00000362795	0.771	C-X-C chemokine receptor type 3
11	9606.ENSP00000295683	0.759	C-X-C chemokine receptor type 1
12	9606.ENSP00000246657	0.756	C-C chemokine receptor type 7
13	9606.ENSP00000343952	0.750	Chemokine (C-C motif) receptor 6
14	9606.ENSP00000219235	0.744	C-C motif chemokine 22
15	9606.ENSP00000231454	0.725	Interleukin-5
16	9606.ENSP00000350256	0.723	C-C chemokine receptor type 9
17	9606.ENSP00000386884	0.720	C-X-C chemokine receptor type 4
18	9606.ENSP00000304915	0.704	Interleukin-13
19	9606.ENSP00000292174	0.702	C-X-C chemokine receptor type 5
20	9606.ENSP00000395704	0.695	C-X-C chemokine receptor type 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008009	1.000	chemokine activity
GO:0048020	0.981	CCR chemokine receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.991	cellular response to stimulus
GO:0002376	0.990	immune system process
GO:0042221	0.990	response to chemical
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0070887	0.979	cellular response to chemical stimulus
GO:0009605	0.978	response to external stimulus
GO:2000145	0.976	regulation of cell motility
GO:0050900	0.974	leukocyte migration
GO:0007154	0.969	cell communication
GO:0040017	0.962	positive regulation of locomotion
GO:0060326	0.962	cell chemotaxis
GO:0030334	0.959	regulation of cell migration
GO:0030595	0.951	leukocyte chemotaxis
GO:0023052	0.933	signaling
GO:0048522	0.932	positive regulation of cellular process
GO:0007165	0.907	signal transduction
GO:2000147	0.881	positive regulation of cell motility
GO:0006950	0.878	response to stress
GO:0044093	0.828	positive regulation of molecular function
GO:0030335	0.815	positive regulation of cell migration
GO:0006952	0.808	defense response
GO:0042127	0.801	regulation of cell population proliferation
GO:0065008	0.789	regulation of biological quality
GO:0050790	0.757	regulation of catalytic activity
GO:0050793	0.739	regulation of developmental process
GO:0031334	0.690	positive regulation of protein-containing complex assembly
GO:0097529	0.671	myeloid leukocyte migration
GO:0006954	0.658	inflammatory response
GO:0051345	0.655	positive regulation of hydrolase activity
GO:0071840	0.634	cellular component organization or biogenesis
GO:0016043	0.622	cellular component organization
GO:0006955	0.620	immune response
GO:1902905	0.618	positive regulation of supramolecular fiber organization
GO:0051495	0.618	positive regulation of cytoskeleton organization
GO:0030838	0.612	positive regulation of actin filament polymerization
GO:0008284	0.594	positive regulation of cell population proliferation
GO:0043087	0.575	regulation of GTPase activity
GO:0043547	0.574	positive regulation of GTPase activity
GO:0051239	0.523	regulation of multicellular organismal process
GO:0002684	0.511	positive regulation of immune system process
GO:0048583	0.438	regulation of response to stimulus
GO:0048584	0.425	positive regulation of response to stimulus
GO:0010033	0.424	response to organic substance
GO:0032501	0.417	multicellular organismal process
GO:0019222	0.416	regulation of metabolic process
GO:0007267	0.388	cell-cell signaling
GO:0009893	0.383	positive regulation of metabolic process
GO:0032101	0.373	regulation of response to external stimulus
GO:0060255	0.370	regulation of macromolecule metabolic process
GO:0032103	0.349	positive regulation of response to external stimulus
GO:0048519	0.345	negative regulation of biological process
GO:0010604	0.345	positive regulation of macromolecule metabolic process
GO:0051240	0.320	positive regulation of multicellular organismal process
GO:0032502	0.302	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0016020	0.944	membrane
GO:0071944	0.937	cell periphery
GO:0005886	0.920	plasma membrane
GO:0005615	0.852	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]