StarFunc result for job id O00182

User Input

>input (355 residues)
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAF
HFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFV
QYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQK
PPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKS
ILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPF
VRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3B8N2	0.945	0.942	9.616E-65	356	0.952	0.949	Q3B8N2.pdb.gz	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
2	AFDB:A0A024QZ02	0.835	0.917	2.744E-60	323	0.910	1.000	A0A024QZ02.pdb.gz
3	AFDB:O08573	0.799	0.803	1.586E-54	353	0.693	0.697	O08573.pdb.gz	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
4	AFDB:P97840	0.481	0.483	7.317E-54	354	0.718	0.720	P97840.pdb.gz	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
5	AFDB:Q8K419	0.576	0.618	4.926E-35	326	0.372	0.405	Q8K419.pdb.gz	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
6	AFDB:P56470	0.590	0.639	6.622E-35	323	0.361	0.396	P56470.pdb.gz	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
7	AFDB:J3QR96	0.555	0.796	8.741E-33	246	0.583	0.841	J3QR96.pdb.gz	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
8	AFDB:O54891	0.577	0.661	9.647E-33	301	0.352	0.415	O54891.pdb.gz	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
9	AFDB:O00214	0.406	0.453	2.855E-32	317	0.321	0.360	O00214.pdb.gz	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
10	AFDB:Q9JL15	0.400	0.449	6.604E-32	316	0.299	0.335	Q9JL15.pdb.gz	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
11	PDB:6m5yA	0.344	0.447	1.614E-19	270	0.206	0.270	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
12	PDB:3vv1A	0.369	0.903	3.047E-13	141	0.115	0.291	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
13	PDB:3zxfB	0.366	0.921	1.212E-12	138	0.132	0.341	3zxfB.pdb.gz
14	PDB:6ljqA	0.364	0.893	4.592E-12	140	0.130	0.329	6ljqA.pdb.gz	Human galectin-16 has a pseudo ligand binding site and plays a role in regulating c-Rel-mediated lymphocyte activity.
15	PDB:5xg7A	0.361	0.892	1.500E-11	139	0.121	0.309	5xg7A.pdb.gz
16	PDB:6l6aA	0.357	0.864	7.637E-11	142	0.113	0.282	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
17	PDB:1w6mA	0.344	0.874	2.621E-10	134	0.090	0.239	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
18	PDB:4ga9A	0.349	0.881	3.354E-10	134	0.093	0.246	4ga9A.pdb.gz	Gal-1 structure analysis
19	PDB:5dg2B	0.347	0.904	3.523E-10	131	0.085	0.229	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
20	PDB:6k2zA	0.299	0.734	4.976E-10	138	0.124	0.319	6k2zA.pdb.gz	Structure-function studies of galectin-14, an important effector molecule in embryology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KSY2	0.0	614	323	0.856	0.941	J3KSY2_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
2	O00182	0.0	730	355	1.000	1.000	LEG9_HUMAN Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2
3	O08573	0.0	509	353	0.693	0.697	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
4	P97840	0.0	524	354	0.718	0.720	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
5	Q3B8N2	0.0	693	356	0.952	0.949	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
6	Q6DKI2	0.0	689	356	0.944	0.941	LEG9C_HUMAN Galectin-9C OS=Homo sapiens OX=9606 GN=LGALS9C PE=1 SV=2
7	J3QR96	5.85e-142	404	246	0.583	0.841	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
8	J3KT17	3.80e-133	381	234	0.555	0.842	J3KT17_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
9	J3KS82	2.96e-104	305	175	0.417	0.846	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
10	J3QSH0	1.35e-97	288	175	0.392	0.794	J3QSH0_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
11	Q8K419	1.13e-64	210	326	0.375	0.408	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
12	P56470	1.98e-60	199	323	0.361	0.396	LEG4_HUMAN Galectin-4 OS=Homo sapiens OX=9606 GN=LGALS4 PE=1 SV=1
13	O54891	1.79e-56	187	301	0.349	0.412	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1
14	Q9JL15	2.85e-53	180	316	0.315	0.354	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
15	O00214	1.10e-52	178	317	0.321	0.360	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
16	Q91VD1	1.07e-30	120	314	0.276	0.312	LEG12_MOUSE Galectin-12 OS=Mus musculus OX=10090 GN=Lgals12 PE=1 SV=2
17	P08699	2.55e-30	118	262	0.211	0.286	LEG3_RAT Galectin-3 OS=Rattus norvegicus OX=10116 GN=Lgals3 PE=1 SV=4
18	P16110	3.02e-30	118	264	0.211	0.284	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
19	Q6NVH9	8.17e-30	116	250	0.208	0.296	Q6NVH9_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
20	A0A024R693	1.00e-29	116	250	0.203	0.288	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00337 Gal-bind_lectin	1.2e-71	249.9	Galactoside-binding lectin
2	PF12380 Peptidase_C62	6.4e+02	10.8	Gill-associated viral 3C-like peptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312002	0.999	Hepatitis A virus cellular receptor 2
2	9606.ENSP00000398632	0.993	CD44 antigen
3	9606.ENSP00000327801	0.938	Protein disulfide-isomerase
4	9606.ENSP00000411355	0.931	Receptor-type tyrosine-protein phosphatase C
5	9606.ENSP00000302569	0.928	C-type lectin domain family 7 member A
6	9606.ENSP00000323568	0.856	Solute carrier family 2, facilitated glucose transporter member 2
7	9606.ENSP00000361359	0.833	Tumor necrosis factor receptor superfamily member 5
8	9606.ENSP00000011653	0.783	T-cell surface glycoprotein CD4
9	9606.ENSP00000254301	0.738	Galectin-3
10	9606.ENSP00000329932	0.735	Galectin-9C
11	9606.ENSP00000400010	0.732	Receptor-type tyrosine-protein phosphatase eta
12	9606.ENSP00000370989	0.730	Programmed cell death 1 ligand 1
13	9606.ENSP00000203629	0.725	Lymphocyte activation gene 3 protein
14	9606.ENSP00000315564	0.705	Galectin-9B
15	9606.ENSP00000383558	0.701	Glucagon receptor
16	9606.ENSP00000478699	0.700	Tumor necrosis factor receptor superfamily member 9
17	9606.ENSP00000386559	0.686	T-cell surface glycoprotein CD8 alpha chain
18	9606.ENSP00000262776	0.684	Galectin-3-binding protein
19	9606.ENSP00000161559	0.673	Carcinoembryonic antigen-related cell adhesion molecule 1
20	9606.ENSP00000332049	0.645	T-lymphocyte activation antigen CD86

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030246	0.940	carbohydrate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0002684	0.997	positive regulation of immune system process
GO:0002831	0.996	regulation of response to biotic stimulus
GO:0048584	0.996	positive regulation of response to stimulus
GO:0050896	0.992	response to stimulus
GO:0050794	0.991	regulation of cellular process
GO:0002376	0.986	immune system process
GO:0048522	0.983	positive regulation of cellular process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0032101	0.979	regulation of response to external stimulus
GO:0051239	0.975	regulation of multicellular organismal process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0032501	0.973	multicellular organismal process
GO:0050776	0.973	regulation of immune response
GO:0032103	0.973	positive regulation of response to external stimulus
GO:0031347	0.969	regulation of defense response
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0001817	0.963	regulation of cytokine production
GO:0045088	0.961	regulation of innate immune response
GO:0051249	0.959	regulation of lymphocyte activation
GO:0050778	0.955	positive regulation of immune response
GO:0048523	0.950	negative regulation of cellular process
GO:0050790	0.945	regulation of catalytic activity
GO:0051246	0.945	regulation of protein metabolic process
GO:0030155	0.943	regulation of cell adhesion
GO:0032879	0.940	regulation of localization
GO:0010033	0.938	response to organic substance
GO:0051173	0.938	positive regulation of nitrogen compound metabolic process
GO:0002696	0.936	positive regulation of leukocyte activation
GO:0050863	0.934	regulation of T cell activation
GO:0051251	0.933	positive regulation of lymphocyte activation
GO:0051049	0.932	regulation of transport
GO:0009966	0.930	regulation of signal transduction
GO:0007165	0.929	signal transduction
GO:1903039	0.929	positive regulation of leukocyte cell-cell adhesion
GO:0002697	0.927	regulation of immune effector process
GO:0001819	0.927	positive regulation of cytokine production
GO:0002683	0.925	negative regulation of immune system process
GO:0050670	0.925	regulation of lymphocyte proliferation
GO:0050870	0.921	positive regulation of T cell activation
GO:0009605	0.917	response to external stimulus
GO:0030335	0.914	positive regulation of cell migration
GO:0008285	0.909	negative regulation of cell population proliferation
GO:0002695	0.904	negative regulation of leukocyte activation
GO:0051707	0.896	response to other organism
GO:0009892	0.893	negative regulation of metabolic process
GO:0009967	0.892	positive regulation of signal transduction
GO:0051247	0.886	positive regulation of protein metabolic process
GO:0060284	0.876	regulation of cell development
GO:0010605	0.874	negative regulation of macromolecule metabolic process
GO:0044093	0.870	positive regulation of molecular function
GO:0048585	0.863	negative regulation of response to stimulus
GO:0043067	0.854	regulation of programmed cell death
GO:0031349	0.842	positive regulation of defense response
GO:0051094	0.841	positive regulation of developmental process
GO:0042129	0.835	regulation of T cell proliferation
GO:2000026	0.829	regulation of multicellular organismal development
GO:0042981	0.827	regulation of apoptotic process
GO:0007162	0.825	negative regulation of cell adhesion
GO:0051250	0.819	negative regulation of lymphocyte activation
GO:0006952	0.800	defense response
GO:1902105	0.791	regulation of leukocyte differentiation
GO:0070887	0.781	cellular response to chemical stimulus
GO:1903038	0.769	negative regulation of leukocyte cell-cell adhesion
GO:0050777	0.759	negative regulation of immune response
GO:0002703	0.754	regulation of leukocyte mediated immunity
GO:0031341	0.751	regulation of cell killing
GO:1903555	0.751	regulation of tumor necrosis factor superfamily cytokine production
GO:1902531	0.747	regulation of intracellular signal transduction
GO:0060627	0.746	regulation of vesicle-mediated transport
GO:0032675	0.720	regulation of interleukin-6 production
GO:0002833	0.716	positive regulation of response to biotic stimulus
GO:0010720	0.709	positive regulation of cell development
GO:0009615	0.707	response to virus
GO:0032945	0.691	negative regulation of mononuclear cell proliferation
GO:0002706	0.678	regulation of lymphocyte mediated immunity
GO:0032680	0.678	regulation of tumor necrosis factor production
GO:0045089	0.677	positive regulation of innate immune response
GO:0002687	0.667	positive regulation of leukocyte migration
GO:1903557	0.666	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0006955	0.652	immune response
GO:0002698	0.646	negative regulation of immune effector process
GO:0032760	0.643	positive regulation of tumor necrosis factor production
GO:0071310	0.642	cellular response to organic substance
GO:0071675	0.641	regulation of mononuclear cell migration
GO:0001910	0.637	regulation of leukocyte mediated cytotoxicity
GO:0051046	0.623	regulation of secretion
GO:0051051	0.616	negative regulation of transport
GO:0071677	0.609	positive regulation of mononuclear cell migration
GO:0022414	0.606	reproductive process
GO:0042269	0.599	regulation of natural killer cell mediated cytotoxicity
GO:0002704	0.598	negative regulation of leukocyte mediated immunity
GO:1903530	0.587	regulation of secretion by cell
GO:0002707	0.579	negative regulation of lymphocyte mediated immunity
GO:0031342	0.571	negative regulation of cell killing
GO:0001911	0.528	negative regulation of leukocyte mediated cytotoxicity
GO:0048856	0.508	anatomical structure development
GO:0034097	0.507	response to cytokine
GO:0009889	0.438	regulation of biosynthetic process
GO:0009617	0.426	response to bacterium
GO:0050727	0.420	regulation of inflammatory response
GO:0098586	0.420	cellular response to virus
GO:0031326	0.409	regulation of cellular biosynthetic process
GO:0043068	0.402	positive regulation of programmed cell death
GO:1901700	0.387	response to oxygen-containing compound
GO:0008152	0.357	metabolic process
GO:0007166	0.345	cell surface receptor signaling pathway
GO:0010556	0.344	regulation of macromolecule biosynthetic process
GO:0098542	0.343	defense response to other organism
GO:0006355	0.316	regulation of DNA-templated transcription
GO:0031325	0.314	positive regulation of cellular metabolic process
GO:0071704	0.313	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0071944	0.904	cell periphery
GO:0043227	0.671	membrane-bounded organelle
GO:0043231	0.581	intracellular membrane-bounded organelle
GO:0005576	0.410	extracellular region
GO:0005886	0.323	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]