StarFunc result for job id O00192

User Input

>input (962 residues)
MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMVSGGMGSGQPL
PMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTVEEDPGTPTSHVSIVTSEDGTTRRT
ETKVTKTVKTVTTRTVRQVPVGPDGLPLLDGGPPLGPFADGALDRHFLLRGGGPVATLSR
AYLSSGGGFPEGPEPRDSPSYGSLSRGLGMRPPRAGPLGPGPGDGCFTLPGHREAFPVGP
EPGPPGGRSLPERFQAEPYGLEDDTRSLAADDEGGPELEPDYGTATRRRPECGRGLHTRA
YEDTADDGGELADERPAFPMVTAPLAQPERGSMGSLDRLVRRSPSVDSARKEPRWRDPEL
PEVLAMLRHPVDPVKANAAAYLQHLCFENEGVKRRVRQLRGLPLLVALLDHPRAEVRRRA
CGALRNLSYGRDTDNKAAIRDCGGVPALVRLLRAARDNEVRELVTGTLWNLSSYEPLKMV
IIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAEARRRL
RECEGLVDALLHALQSAVGRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGPL
GSAVGSQRRRRDDASCFGGKKAKEEWFHQGKKDGEMDRNFDTLDLPKRTEAAKGFELLYQ
PEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWMWATYIRATVRKERGLPVLVELLQS
ETDKVVRAVAIALRNLSLDRRNKDLIGSYAMAELVRNVRNAQAPPRPGACLEEDTVVAVL
NTIHEIVSDSLDNARSLLQARGVPALVALVASSQSVREAKAASHVLQTVWSYKELRGTLQ
KDGWTKARFQSAAATAKGPKGALSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDG
YSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDS
WV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00192	1.000	1.000	0.000	962	1.000	1.000	O00192.pdb.gz	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
2	AFDB:O60716	0.545	0.542	6.467E-58	968	0.468	0.465	O60716.pdb.gz	CTND1_HUMAN Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
3	AFDB:A0A286Y8C1	0.513	0.529	5.082E-55	931	0.444	0.459	A0A286Y8C1.pdb.gz	A0A286Y8C1_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
4	AFDB:Q99569	0.465	0.378	1.687E-39	1192	0.381	0.308	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
5	AFDB:A1L266	0.251	0.302	2.453E-23	794	0.248	0.301	A1L266.pdb.gz
6	PDB:2z6gA	0.273	0.426	3.032E-11	550	0.103	0.180	2z6gA.pdb.gz
7	PDB:7rroH7	0.182	0.284	1.050E-9	580	0.106	0.176	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
8	AFDB:G5E870	0.243	0.129	1.055E-9	2025	0.150	0.071	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
9	AFDB:Q9W517	0.256	0.157	1.543E-9	1741	0.143	0.079	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
10	PDB:4r0zA	0.309	0.508	4.794E-9	557	0.091	0.158	4r0zA.pdb.gz
11	PDB:4tnmA	0.323	0.717	1.850E-8	407	0.076	0.179	4tnmA.pdb.gz
12	PDB:5tbkA	0.324	0.704	1.929E-8	417	0.072	0.165	5tbkA.pdb.gz
13	PDB:6kbnC	0.343	0.628	2.821E-8	504	0.097	0.185	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
14	PDB:1wa5B	0.331	0.639	3.953E-8	466	0.082	0.170	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
15	AFDB:Q5H9R4	0.224	0.099	3.419E-7	2290	0.103	0.043	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
16	PDB:3tpoA	0.283	0.534	4.380E-7	438	0.072	0.158	3tpoA.pdb.gz
17	AFDB:P25822	0.122	0.092	1.929E-6	1533	0.115	0.072	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
18	PDB:7nscE	0.211	0.290	2.688E-6	615	0.067	0.104	7nscE.pdb.gz
19	PDB:4hm9A	0.284	0.483	7.400E-6	511	0.075	0.141	4hm9A.pdb.gz
20	AFDB:A0A0R4IZ84	0.132	0.096	1.401E-5	1544	0.135	0.084	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JXM1	0.0	791	967	0.481	0.479	A0A0G2JXM1_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
2	A0A286Y8C1	0.0	692	931	0.456	0.472	A0A286Y8C1_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
3	A0A669KB05	0.0	758	915	0.480	0.505	A0A669KB05_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
4	A0A669KB62	0.0	719	888	0.468	0.507	A0A669KB62_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
5	A0A8I5ZVG2	0.0	712	870	0.435	0.480	A0A8I5ZVG2_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
6	C9JZR2	0.0	757	938	0.479	0.491	C9JZR2_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=2
7	D3ZZZ9	0.0	725	892	0.436	0.470	D3ZZZ9_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=2
8	F1R6C8	0.0	676	908	0.453	0.480	F1R6C8_DANRE Catenin (cadherin-associated protein), delta 1 OS=Danio rerio OX=7955 GN=ctnnd1 PE=1 SV=2
9	O00192	0.0	1943	962	1.000	1.000	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
10	O60716	0.0	757	968	0.479	0.476	CTND1_HUMAN Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
11	P30999	0.0	768	938	0.480	0.493	CTND1_MOUSE Catenin delta-1 OS=Mus musculus OX=10090 GN=Ctnnd1 PE=1 SV=2
12	P98203	0.0	1713	962	0.919	0.919	ARVC_MOUSE Splicing regulator ARVCF OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2
13	Q8AXM9	0.0	551	859	0.399	0.447	CTND1_XENLA Catenin delta-1 OS=Xenopus laevis OX=8355 GN=ctnnd1 PE=1 SV=1
14	Q9UQB3	1.50e-157	498	1225	0.272	0.214	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
15	O35927	1.96e-151	482	1247	0.268	0.207	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
16	Q68FH0	2.30e-151	480	1190	0.267	0.216	PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1
17	B0V2S9	3.36e-150	478	1210	0.258	0.205	B0V2S9_DANRE Catenin (cadherin-associated protein), delta 2b OS=Danio rerio OX=7955 GN=ctnnd2 PE=1 SV=1
18	Q99569	3.50e-150	477	1192	0.264	0.213	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
19	Q8T0H3	3.15e-132	411	562	0.245	0.420	Q8T0H3_DROME LD03740p OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1
20	Q9NHP1	6.26e-131	415	781	0.245	0.302	Q9NHP1_DROME Arm repeat protein OS=Drosophila melanogaster OX=7227 GN=p120ctn PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	8.5e-37	135.3	Armadillo/beta-catenin-like repeat
2	PF04826 Arm_2	23	15.9	Armadillo-like
3	PF09759 Atx10homo_assoc	12	17.3	Spinocerebellar ataxia type 10 protein domain
4	PF02985 HEAT	4.6e-05	34.3	HEAT repeat
5	PF13646 HEAT_2	0.0007	31.3	HEAT repeats
6	PF13513 HEAT_EZ	2e-08	45.9	HEAT-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426632	0.901	Erbin
2	9606.ENSP00000438262	0.870	Tight junction protein ZO-2
3	9606.ENSP00000365198	0.805	Kazrin
4	9606.ENSP00000384638	0.777	Catenin alpha-2
5	9606.ENSP00000383365	0.775	Thioredoxin reductase 2, mitochondrial
6	9606.ENSP00000354511	0.769	Catechol O-methyltransferase
7	9606.ENSP00000304669	0.755	Catenin alpha-1
8	9606.ENSP00000027335	0.736	Cadherin-17
9	9606.ENSP00000363317	0.736	FERM and PDZ domain-containing protein 2
10	9606.ENSP00000253413	0.720	V-type proton ATPase subunit E 1
11	9606.ENSP00000314153	0.716	Transcriptional regulator Kaiso
12	9606.ENSP00000371897	0.675	Rho GTPase-activating protein 5
13	9606.ENSP00000376457	0.666	Protein ECT2
14	9606.ENSP00000400175	0.630	Transforming protein RhoA
15	9606.ENSP00000261769	0.626	Cadherin-1
16	9606.ENSP00000344456	0.624	Catenin beta-1
17	9606.ENSP00000281537	0.595	Tight junction protein ZO-1
18	9606.ENSP00000467423	0.594	Scaffold attachment factor B1
19	9606.ENSP00000035383	0.592	Leucine-rich repeat-containing protein 7
20	9606.ENSP00000369592	0.591	Coiled-coil domain-containing protein 85C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	0.999	cell adhesion molecule binding
GO:0045296	0.983	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007155	0.904	cell adhesion
GO:0071704	0.873	organic substance metabolic process
GO:0006807	0.782	nitrogen compound metabolic process
GO:0044237	0.760	cellular metabolic process
GO:0044238	0.755	primary metabolic process
GO:0065007	0.638	biological regulation
GO:0043170	0.626	macromolecule metabolic process
GO:0050789	0.577	regulation of biological process
GO:0050794	0.553	regulation of cellular process
GO:1901360	0.454	organic cyclic compound metabolic process
GO:0006725	0.436	cellular aromatic compound metabolic process
GO:0046483	0.412	heterocycle metabolic process
GO:0006139	0.375	nucleobase-containing compound metabolic process
GO:0090304	0.318	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.998	nucleus
GO:0016020	0.995	membrane
GO:0032991	0.993	protein-containing complex
GO:0005886	0.991	plasma membrane
GO:0005911	0.932	cell-cell junction
GO:0005829	0.931	cytosol
GO:0005912	0.709	adherens junction
GO:0043232	0.321	intracellular non-membrane-bounded organelle
GO:1990904	0.312	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]