StarFunc result for job id O00198

User Input

>input (91 residues)
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAP
APGALPTYWPWLCAAAQVAALAAWLLGRRNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00198	1.000	1.000	1.935E-14	91	1.000	1.000	O00198.pdb.gz	HRK_HUMAN Activator of apoptosis harakiri OS=Homo sapiens OX=9606 GN=HRK PE=1 SV=1
2	AFDB:Q91Z96	0.299	0.041	1.364	1138	0.187	0.015	Q91Z96.pdb.gz	BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus OX=10090 GN=Bmp2k PE=1 SV=1
3	AFDB:Q9NQX5	0.371	0.121	1.745	325	0.231	0.065	Q9NQX5.pdb.gz	NPDC1_HUMAN Neural proliferation differentiation and control protein 1 OS=Homo sapiens OX=9606 GN=NPDC1 PE=1 SV=2
4	AFDB:O44782	0.382	0.155	1.895	245	0.253	0.094	O44782.pdb.gz	O44782_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=vpr-1 PE=1 SV=1
5	AFDB:Q78HU7	0.247	0.239	3.656	95	0.198	0.189	Q78HU7.pdb.gz	GLPC_MOUSE Glycophorin-C OS=Mus musculus OX=10090 GN=Gypc PE=1 SV=2
6	AFDB:Q9NET8	0.287	0.076	4.310	366	0.165	0.041	Q9NET8.pdb.gz	Q9NET8_CAEEL Verprolin OS=Caenorhabditis elegans OX=6239 GN=dyf-17 PE=4 SV=1
7	AFDB:Q53GC0	0.329	0.148	5.987	236	0.242	0.093	Q53GC0.pdb.gz	Q53GC0_HUMAN SERTA domain containing 1 variant (Fragment) OS=Homo sapiens OX=9606 GN=SERTAD1 PE=1 SV=1
8	AFDB:O15083	0.479	0.051	7.661	957	0.143	0.014	O15083.pdb.gz	ERC2_HUMAN ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3
9	AFDB:Q8IKV1	0.302	0.137	7.661	211	0.154	0.066	Q8IKV1.pdb.gz	Q8IKV1_PLAF7 Syntaxin-6, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1452500 PE=4 SV=2
10	PDB:6ft6s	0.243	0.309	7.790	69	0.132	0.174	6ft6s.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
11	AFDB:Q9H0G5	0.302	0.052	8.317	558	0.132	0.022	Q9H0G5.pdb.gz	NSRP1_HUMAN Nuclear speckle splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=NSRP1 PE=1 SV=1
12	PDB:5oqj1	0.248	0.067	8.457	491	0.209	0.039	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00198	6.13e-58	174	91	1.000	1.000	HRK_HUMAN Activator of apoptosis harakiri OS=Homo sapiens OX=9606 GN=HRK PE=1 SV=1
2	P62817	7.52e-17	70.5	92	0.703	0.696	HRK_RAT Activator of apoptosis harakiri OS=Rattus norvegicus OX=10116 GN=Hrk PE=3 SV=1
3	A2BIK1	0.27	31.6	603	0.209	0.032	A2BIK1_DANRE Beta-galactosidase OS=Danio rerio OX=7955 GN=si:dkey-224e22.2 PE=1 SV=1
4	P09551	1.2	29.6	260	0.176	0.062	ARGT_ECOLI Lysine/arginine/ornithine-binding periplasmic protein OS=Escherichia coli (strain K12) OX=83333 GN=argT PE=1 SV=3
5	O88900	1.7	29.3	538	0.209	0.035	GRB14_RAT Growth factor receptor-bound protein 14 OS=Rattus norvegicus OX=10116 GN=Grb14 PE=1 SV=1
6	A0A140VJY2	2.0	29.3	704	0.220	0.028	A0A140VJY2_HUMAN Testicular tissue protein Li 209 OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q12931	2.0	29.3	704	0.220	0.028	TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3
8	Q9VUV3	2.5	28.9	637	0.264	0.038	Q9VUV3_DROME PH-sensitive chloride channel 1, isoform C OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=2 SV=2
9	Q9VUV2	2.9	28.5	737	0.264	0.033	Q9VUV2_DROME PH-sensitive chloride channel 1, isoform D OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=3
10	X2JCG3	2.9	28.5	770	0.264	0.031	X2JCG3_DROME PH-sensitive chloride channel 1, isoform T OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=2
11	X2JGQ0	3.0	28.5	755	0.264	0.032	X2JGQ0_DROME PH-sensitive chloride channel 1, isoform U OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=2
12	E1JI08	3.2	28.5	681	0.264	0.035	E1JI08_DROME PH-sensitive chloride channel 1, isoform G OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
13	M9NEB0	3.2	28.5	762	0.264	0.031	M9NEB0_DROME PH-sensitive chloride channel 1, isoform H OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
14	M9PFD4	3.2	28.5	746	0.264	0.032	M9PFD4_DROME PH-sensitive chloride channel 1, isoform K OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
15	M9PFD7	3.2	28.5	754	0.264	0.032	M9PFD7_DROME PH-sensitive chloride channel 1, isoform P OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
16	M9NFY2	3.3	28.5	754	0.264	0.032	M9NFY2_DROME PH-sensitive chloride channel 1, isoform I OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
17	M9PFR7	3.4	28.5	747	0.264	0.032	M9PFR7_DROME PH-sensitive chloride channel 1, isoform L OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
18	Q2PDZ0	3.4	28.5	762	0.264	0.031	Q2PDZ0_DROME PH-sensitive chloride channel 1, isoform E OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
19	Q2PDY9	3.7	28.5	779	0.264	0.031	Q2PDY9_DROME PH-sensitive chloride channel 1, isoform F OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1
20	M9PCN0	3.8	28.5	772	0.264	0.031	M9PCN0_DROME PH-sensitive chloride channel 1, isoform J OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06252 GemA	89	15.5	Bacteriophage Mu, GemA protein
2	PF15196 Harakiri	2.2e-47	170.8	Activator of apoptosis harakiri

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000325

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011718	0.943	BCL2-like 1
2	61853.ENSNLEP00000010587	0.863	BCL2, apoptosis regulator
3	61853.ENSNLEP00000012087	0.806	MCL1, BCL2 family apoptosis regulator
4	61853.ENSNLEP00000018241	0.746	BCL2-like 2
5	61853.ENSNLEP00000010806	0.702	BCL2-related protein A1
6	61853.ENSNLEP00000002811	0.691	Bcl-2-like protein 11
7	61853.ENSNLEP00000003047	0.691	Bcl2 modifying factor
8	61853.ENSNLEP00000019510	0.677	BCL2-interacting killer (apoptosis-inducing)
9	61853.ENSNLEP00000007888	0.630	BCL2-like 10 (apoptosis facilitator)
10	61853.ENSNLEP00000015433	0.627	Belongs to the peptidase S9B family.
11	61853.ENSNLEP00000009435	0.555	BOK, BCL2 family apoptosis regulator
12	61853.ENSNLEP00000004207	0.522	BCL2-like 14 (apoptosis facilitator)
13	61853.ENSNLEP00000018250	0.522	annotation not available
14	61853.ENSNLEP00000023052	0.519	Retrotransposon Gag like 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0043065	0.986	positive regulation of apoptotic process
GO:0010821	0.950	regulation of mitochondrion organization
GO:0090199	0.943	regulation of release of cytochrome c from mitochondria
GO:0051130	0.930	positive regulation of cellular component organization
GO:0010822	0.917	positive regulation of mitochondrion organization
GO:0044089	0.910	positive regulation of cellular component biogenesis
GO:0031334	0.882	positive regulation of protein-containing complex assembly
GO:0009987	0.835	cellular process
GO:0050896	0.810	response to stimulus
GO:0051716	0.744	cellular response to stimulus
GO:0012501	0.730	programmed cell death
GO:0006915	0.697	apoptotic process
GO:0007154	0.631	cell communication
GO:0023052	0.346	signaling
GO:0019222	0.329	regulation of metabolic process
GO:0006950	0.328	response to stress
GO:0007165	0.310	signal transduction
GO:0033554	0.301	cellular response to stress
GO:0090200	0.300	positive regulation of release of cytochrome c from mitochondria

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0016020	0.845	membrane
GO:0032991	0.595	protein-containing complex
GO:0005829	0.524	cytosol
GO:0005634	0.380	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]